SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004235 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004235
Domain Number 1 Region: 1743-1783,1822-2017
Classification Level Classification E-value
Superfamily Plakin repeat 1.57e-65
Family Plakin repeat 0.000011
Further Details:      
 
Domain Number 2 Region: 204-329
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000104
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 3 Region: 1644-1741
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000000000243
Family Plakin repeat 0.011
Further Details:      
 
Domain Number 4 Region: 100-199
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000135
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 5 Region: 708-799
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000151
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004235   Gene: ENSMGAG00000004396   Transcript: ENSMGAT00000004948
Sequence length 2036
Comment pep:novel chromosome:UMD2:20:4561493:4577010:1 gene:ENSMGAG00000004396 transcript:ENSMGAT00000004948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QHRGRSLSSMFKAVGKGSPSRNAPSRASPAKPSKSSSSELAVLIARMQTNADQVEKDILE
TQSLLTQDVSNEQKNKAFEFQAENARNLKEAETLLKDLFLDVDRAKRLKHPQATEIEKDI
QQLHERVTQLCAEYRDLYEKLNVPDIGPRVDWTKILDQKMKQVNAGQYGPGMSELEKQIA
EHNILQKEIEAYGLQIKNLRCRDVTDLKSQYKDLLKASIWRGQSLGSLYHHLQGCTKELG
YLTERQTRILKQDWSDQMTDVQSMRREYEDFKSKELLSQEEFVNNLQDDGDRMIELKHPA
VKPIQAHQEALKNEWQNFLNLCICQESQLKSVENYKKFQDDAETVSRSLKKMSSDLDTKY
TKFNKDSPGVVSDLLLHLENDEKSVKQAEKSIADLKKRSKEISPLKLRRMRSSQPLTLDT
LCDWDAGEVQLTRGDKYTLKDNSNPEMWVVQSSTGVVQEAPSACFSILPPDPEAVDKVNR
LEGELNAVKQKRAAAQSMLRRSHKETVQPSQQVLPKSTPVVQDDPQADQLLGSLDRVGKD
LVQVEKEVLNRVRSPVSYTDPTDDLARRIKQQQETTKKLESLGAAKDALQKECETYLSKK
PTSTSASQLPVTLNALRSKYSDVSMLSSLYNEKAKAALNLETQIENTDKVVSTFEAKLAQ
DSIIPASPNALQDRANDLQKMKRDLVAQEDCVLKLNRGLKDAEHSCSAVQNNFQEYCPDL
PRQKREVQLLNDRYHAVADQLDQREKTLRNISLTYQQFQNSNENLMFWMNNLPKHQVKTT
DGPSQINYKLQAQKEWHAEWYQPALEQPLSXPADSSVFGSEQDYELQAGKYSSSLDPALT
DFAAKRLRVTPLQESIQAQENDVSKHYMELAAENRQQLSRLEFAKKIVEKKEVHEDIQSV
HEQTQQSANKAVSSRESEGLKLQLEEERRNVARIEEELEEHRNKLLMLKTQRPVERVEEK
EVVEYYRDPQLESNLTKMMRQIEEEGKKRQSLQEDIELMSRKLAQMESEKKAVPAQLLTK
EITKIEKDPSLDSQAASLRQEIRRLQEESLAAASELEQCKRELHMLERKQPNIREKVVVK
ELIKTEKNPEMLKSVRNLQLQIDEESFKRKSAEEAIVKVKSKIEEVEKLIDAAEPKIIVK
EVKQVEQDPELLKESSKLKTLIEEERSKNLALAGELGELQSQCSIAEKQKPRVEVKERVN
EIFMVDPETEKEIAHLKRELQEVTLKRTKIDSEVEEALAELSVLRSQKPEVELKEVIEEV
VKHEKSPEILREIDRLKQQLNELVNTNGRTQEQLIRLQGERDEWKRERSKVETKLVNKEV
IRYENDPLLEKEADRLRQEVRSMAQKRRAAEDAIYDLQNKYMLLERRKPEEKVIVQEVIL
TQKDPKLRDEHNRLSRSLDEEVSNRRRLERDVQQLRVLVEEQEKLLNFQEDRSKRLALEK
EMRQITLRIKELEESPAPVQEKIIMEEVVKLEKDPVLEQSASNLRLELDREKMEVLNLQR
ECKNLQMQVDVLQKAKSQEKTIYKEVIRVEKDRALESERARIWEQLSRERGAKQKAEEEV
RRLREKIERAEGMKRTWAREETELQKARNLAIQERASLESELRELERQKQQKVLFLREES
KLLNQRTESDRQKKKQLEQEFSMLEADILREKDQIYNKERFIRDLRSRVSREEINHETQM
RETNLSTKISILDPETGKDMSPYEAYKRGIIDRGQYIQLQELECDWEEITTLGPNGEVSV
LLDKKSGKQYSIDDALRLRRITKEEYQLYRDGKIPISEFALLVAGESKPPSSLSIGSIIS
KSPIQSPTTPQTQSFFPPGSQKGFSDDTSPIAGVYDTTTDTKYNIKTAVTKKLLDPMTAQ
KLLEAQAATGGIIDLLSRDRLSVHKAIERGLIDRTYMQRLLNAQKAFTGIEDPVTKRRLS
VGEAVQKGWMTKDSAFPYLEVQHLTGGLIDPKKTGRIPVLEAAHMGMITGDLANRLQDES
SYEKDLIDPITKEKINYKEAMALCQKDSLGSLLLLPAASEGYQPYRSPKLSRSCIL
Download sequence
Identical sequences G1MZ10
ENSMGAP00000004235 ENSMGAP00000004235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]