SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004271 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004271
Domain Number 1 Region: 150-424
Classification Level Classification E-value
Superfamily Caspase-like 3.59e-81
Family Caspase catalytic domain 0.00000000462
Further Details:      
 
Domain Number 2 Region: 10-102
Classification Level Classification E-value
Superfamily DEATH domain 9.42e-24
Family Caspase recruitment domain, CARD 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004271   Gene: ENSMGAG00000014169   Transcript: ENSMGAT00000004984
Sequence length 427
Comment pep:known_by_projection chromosome:UMD2:1:81328289:81354721:-1 gene:ENSMGAG00000014169 transcript:ENSMGAT00000004984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTRMLGACGMQRYHQEALKKNRVMLARELVLKELMEHMIEKDIITIEMVEMIQAKSGSFS
QNVEFLNLLPKRGPNAFSAFCEALQETKQQHLAETILKTESSLRHGIARLEQRYGSDLPL
PLSESCNSKRPRLIVERSLDSGDGPSIPPVKHCTPEFYHDHQHLAYKLISEPRGLALILS
NIHFSSEKDLEYRSGGDVDCASLELLFKHLGYQVTVFHDQSAEEMESALERFSKLPDHQD
VDSCIVALLSHGVEGGVYGTDGKLLQLQEAFRLFDNANCPNLQNKPKMFFIQACRGGECS
XGVDQRDGKERSDSPGCEESDANKEENLKLRLPTCSDMICGYACLKGTAAMRNTKRGSWY
IEALTTVFAEESRDTHVADMLVKVNRQIKQREGYAPGTEFHRCKEMSEYCSTLCQDLYLF
PGYVPGK
Download sequence
Identical sequences G1MZ40
ENSMGAP00000004271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]