SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004283 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004283
Domain Number 1 Region: 6-93
Classification Level Classification E-value
Superfamily E set domains 8.82e-17
Family Other IPT/TIG domains 0.00000737
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004283   Gene: ENSMGAG00000004422   Transcript: ENSMGAT00000004997
Sequence length 925
Comment pep:known_by_projection chromosome:UMD2:3:13829185:13944075:-1 gene:ENSMGAG00000004422 transcript:ENSMGAT00000004997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRARQPPLVTGISPNEGISWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKI
VCRVGQAKNDKGDIIVTTKSGGRGTSTVSFKLLKPEKIGILDQSAVWVDEMNYYDMRTDR
NKGIPPLSLRPANPLGIEIDKGRFPQKDLEMLFPGMSADFTSENFSAAWYLIENHSTTSF
DQLKMAVVHLKKQANKKSEGSLAYVKGGLSTFFEAQDALSAIHQKLEADGTEKVEGSMTQ
KLENVLNRASNTADTLFQEVLGRKDKADSTRNALNVLQRFKFLFNLPLNIERNIQKGDYD
VVINDYEKAKSLFGKTEVQVFKKYYAEVETRIEALRELLLDKLLETPSTLHDQKRYIRYL
SDLHAPGDPAWQCIGAQHQWILQLMHNCKESYVKEQKGTSLLHSSMLDLDSDVRPSPIGH
LSQTASLKRGSSFQSGRNDAWRYKAPQQVVFVEKLTKLVVSQLPNFWKLWISYVNGSLFS
ETAEKSGQMEKSKKNARQRQNDFKKMIQEVMHSLEKLIRGALLPFSLKEGESRQYGGWEM
KSELSGQWLTHVIQTVRLSSESLTALEIPNDMLQIIQDLILDLRVRCIIVTLQHTAEDIK
RLAEKEDWVVDNEGLTSLPSHFEQCIVHSLQSLKTVLDCKPGEASVFQQQKIQEDVCQLS
IGILQVFIDCLEQLSTKPDGDIDTSHLSVDVSSPDLFGSIHEDSSLTSEQRVLIALSNCR
YLERHTFLNIAEHFEKHGFQGVDKITQVSMESLKELDQRLFEMYIESKADPIVGSLEPGI
YAGYFDWKDCLVPAGVRNYLKEALVNIIAVHAEVFTISKDLVPRVMSKIVEAVSEELSRL
MQCVSSFSKNGALQARLEICALKDTVAIYLTPDSNSSFKQALEALPQISSGADKKLLEEL
LNKFKSSMHLQLTCFQTSSSAMIKT
Download sequence
Identical sequences G1MZ48
ENSMGAP00000004283 XP_003204821.1.16129 ENSMGAP00000004283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]