SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004486 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004486
Domain Number 1 Region: 324-427
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000095
Family Spectrin repeat 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004486   Gene: ENSMGAG00000004667   Transcript: ENSMGAT00000005203
Sequence length 435
Comment pep:known_by_projection chromosome:UMD2:2:7533679:7536597:-1 gene:ENSMGAG00000004667 transcript:ENSMGAT00000005203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKALSPLLRDCAAMERVSKMSSYQADYWACAIPDSLPPSPDRQSPHWNPNKEYEDLLDYT
YPLKPKYKLGKVPEPLFHDSGVDLDSFSLSPEGTFRSTSIYGLGWQDQGRRENQHQGAVA
STRRNSTPVAGKAGNAGALSRYEPSPIAKASLARSASSAGAAGPAGGFAKGLTHKGKVKS
AERFLPTTQVLPLRREWDGDEEFLSLPPRLRELETLSQILSDLSLTIRTPRQSHWDSPPR
SNGLESKWAPFGKVGSRDQRQRTGGPAGLCHPYGWDSTQPSSRINRDPLHRPHLPASSRA
VLEGTRLSRLHAAGCPTEGEQWSESLTQCIKVFCHQLEELICWLYDVADTADGWVPPMPD
AASVRAALHRYLEFRKDVADHRSLTESVLQRGAALLECMASNSPALKDTLGLIEKQSEEL
ENHAERLYQSVLAAV
Download sequence
Identical sequences G1MZL1
ENSMGAP00000004486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]