SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004533 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004533
Domain Number 1 Region: 16-165
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.71e-35
Family DBL homology domain (DH-domain) 0.0000888
Further Details:      
 
Domain Number 2 Region: 174-319
Classification Level Classification E-value
Superfamily PH domain-like 1.45e-31
Family Pleckstrin-homology domain (PH domain) 0.00084
Further Details:      
 
Domain Number 3 Region: 434-564
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.32e-30
Family DEP domain 0.0012
Further Details:      
 
Domain Number 4 Region: 336-451
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.71e-29
Family DEP domain 0.0038
Further Details:      
 
Domain Number 5 Region: 551-629
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000426
Family PDZ domain 0.038
Further Details:      
 
Domain Number 6 Region: 641-699
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000122
Family PDZ domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004533   Gene: ENSMGAG00000004640   Transcript: ENSMGAT00000005251
Sequence length 1559
Comment pep:novel chromosome:UMD2:22:6675261:6755832:-1 gene:ENSMGAG00000004640 transcript:ENSMGAT00000005251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSLQAFLHRIRQNAVDKAEKYITEENVKILFSNIEDILGVHKEFLAALEFCLQPEPQSQH
ELGNVFLKFKDKFFVYEEYCSNHEKALRLLMELNKIPTVRAFLLSCMLLGGRKTTDIPLE
GYLLTPIQRICKYPLLLKELIKDTLCKSTDHTIAENLSALVPNISEKQHNFKWIKEIEVY
QSNREKFQGSNLTDICTQLLLQGTLLKISAGNIQERMFFLFDNLLVYCKRKSRVAGKKPS
KRTKSINGSLYIFRGRINTEVMEVENVEDGTADYHSNGYTVTNGWKIHNTAKNKWFVCMA
KTAEDKQKWLDAIIKEREQRESLKLGMERDAYVMIAEKGEKLYQMMMSKKVNLIKDRRRK
LSTVPKCFLGNEFVSWLTDIGEISKPEEGVNLGQALLENGIIHHVSDKHQFKNEQVMYRF
RYDDGTYKPRSELEDIVSKGVRLYCRLHCLYTPVVKDRDYHLKTYKSVIPASKLVDWLIA
QGDCQTREEAVALGVGLCNNGFMHHVLEKSEFKDESLYFRFYADEEMEGTSSKSKQLRND
FKLVENILGKGLLILPEEDDYGFDIEEKNKAVVVKSVRRGSSAEMAGLQAGRKIYSINED
LVFLRPFTEVETILNQSFCSRRPLRLLVAIKSKEIIKIPDCPEALCFQIRGAAPPYVHAV
GRGSEAAAVGLHPGQCILKVNGSNASHGNYMDVLEHFTAYRTKQQEVLGLYQWVYRTHED
AEEDRVQQAASRDEDLDPLQNIHQESAQIQQTISSPLISGEETPLISLTVDNTHLEHGVV
YEYVSSAGIKSFVLEKIVEPKGCFCLTAKILEAFAAEDNHFVRNCKRLISLSSAVATMPQ
YEFRQICDTKLESISRRLANYQEFADGLKTKVSPAFKQAIMEPHSLNSMDFCPTNCHINL
MEVSYPKNTTSAGRSFSIRIGRKPSIIGLDPEQGTVNPVSYTQHCITTMAAPSWRCLTPE
DGDLDGSFGQQNGGTSQEERGLSFLLKQEDREIQDSYLHLFNKLDIAVKEMKQYVVQINK
LLSTITEPTEAGVCEPPSTEESSPPSLGTEESDPEKAEHGGIKKVCFKVSEEDQEDSGHD
TMSFRDSYSECNSNRDSVLSYTSVRSNSSYLGSDEMGSGDELPSDMRIPLDKQDKLHGCL
EHLFNQVQKGLLLLQRIAFSLSVSTQEFFCQHSSCQSQETPTLTTMSHYFLYPIISFSSQ
ILDSSLHQSLLESGCPYVRSDLVAFREGLLLTVDELKLQTPCLNRRRCTYSRQAAVNVKT
YRKREDKKGKLLLLYRNVLNIANIKEERTMLEDIQVTLTELDKVAFYFKQLDESLVANTH
VFYHIEGSRQALKVIFYLDSYYFSKLPSRFQNGGSLKLHTVLFTKALESMEGQSQPAGLS
LEELPQQINGQSLEKVQQYYRKLRTFYLERSNLPTDSNTTAVKIDQLIRPINAMDELCRL
MKSFINTKPTPSGYSSSNTSGAGLLPISSELCYRLGACQITMCGTGMQRSTLSVSLEQAA
ILARSHGLLPKCIMQATDIMRKQGPRVEISAKNLKVMDQMPQCAPRLYRLCQPPTDGDL
Download sequence
Identical sequences G1MZP3
ENSMGAP00000004533 ENSMGAP00000004533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]