SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004550 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004550
Domain Number 1 Region: 32-404
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 5.93e-130
Family Protein prenyltransferases 0.00000000000764
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004550   Gene: ENSMGAG00000004691   Transcript: ENSMGAT00000005269
Sequence length 412
Comment pep:novel chromosome:UMD2:5:6275073:6286689:1 gene:ENSMGAG00000004691 transcript:ENSMGAT00000005269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGPYLVSSADLCKNCHHLIAHHEYTFSVVDDYQSKVEDIVQEVFDAYKTNHHAVQFILQR
EKHFHYLKRGLRQLGEAYECLDASRPWLCYWILHSLELLEEPIPQSIASDVCQFLSCCQS
PQGGFGGGPGQHPHLAPTYAAVNALCIIGTEEAYSIIDRQKLLEYLHTLKQPDGSFLMHV
GGEVDVRSAYCAAAVASLTNVLTPALFTGTAEWIARCQNWEGGIGGVPGMEAHGGYTFCG
LAALVILKKEHLLNLRSLLHWVTGRQMHFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRAL
HTQGDEALSMSRWMFDQSALQEYILLCCQCPAGGLLDKPGKSRDFYHTCYCLSGLAIAQH
FGSGDLHHELVLGIPENRLQPTHPIYNIVPEKVVKAVMHFLQQPVPSLEATG
Download sequence
Identical sequences G1MZQ5
ENSMGAP00000004550 ENSMGAP00000004550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]