SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004565 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004565
Domain Number 1 Region: 177-445
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.87e-82
Family Protein kinases, catalytic subunit 0.000000000526
Further Details:      
 
Domain Number 2 Region: 68-211
Classification Level Classification E-value
Superfamily SH2 domain 6.92e-41
Family SH2 domain 0.00000358
Further Details:      
 
Domain Number 3 Region: 10-93
Classification Level Classification E-value
Superfamily SH3-domain 2.54e-22
Family SH3-domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004565   Gene: ENSMGAG00000004710   Transcript: ENSMGAT00000005285
Sequence length 455
Comment pep:known_by_projection chromosome:UMD2:25:4835233:4840718:-1 gene:ENSMGAG00000004710 transcript:ENSMGAT00000005285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPPCSPLQDKLVVALYDYEPTHDGDLGLKQGEKLRVLEESGEWWKAQSLTTGQEGLIPHN
FVAMVNSLEPEPWFFKNLSRKDAERQLLASGNTHGSFLIRESETSKGSYSLSVRDFDQNQ
GETVKHYKIRNMDNGGYYISPRVTFSSLHELVEYYSSSSDGLCTRLGKPCRTQKPQKPWW
QDEWEVPRESLKLVEKLGAGQFGEVWMGYYNGHTKVAIKNLKQGSMSPSAFLAEANLMKN
LQHPRLVRLYAVVTKEPIYIITEYMEKGSLVDFLKTSEGIKLSINKLLDMAAQIAEGMAF
IEAKNYIHRDLRAANILVSEALCCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINY
GTFTIKSDVWSFGILLTEIVTYGRIPYPGMTNPEVIQNLERGYRMPQPDNCPRELYELMM
LCWKEQPEERPTFEYMKSVLEDFFTATEGQYQQQP
Download sequence
Identical sequences G1MZR7
ENSMGAP00000004565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]