SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004608 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004608
Domain Number 1 Region: 354-557
Classification Level Classification E-value
Superfamily p53-like transcription factors 9.94e-16
Family DNA-binding domain from NDT80 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004608   Gene: ENSMGAG00000004733   Transcript: ENSMGAT00000005328
Sequence length 1168
Comment pep:known_by_projection chromosome:UMD2:5:6376156:6399359:-1 gene:ENSMGAG00000004733 transcript:ENSMGAT00000005328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLTAVVSISSILAGHDINGALEPSNIDTSILEEYISKEDSPDICFPDISASSGCTHPQPS
SSATISTPLPSSIGIAGHVNNPASSGSLHLPPPGSQIPIHHGPLLANPCGPSYGAHLNCN
NNNGMAVPKGYLSGHCLNSMVPPIKSEPKASYAPGTLPDSPPDSGSEAYSPQQVTVQDPH
LLRTMTPENMCHVIPPSRLEHPPPPPPPPPPPPTPHYPGLQRDLYMKTEPLMPPYGMGQG
IAPADLHHTQQSQMLHQLLQQHGADLPVHPAKKRKHSESPPSTLSAQMLNGLIKQEPGMG
SVPLNPERVPTPPWHQPGPLSPGDDLLPYACTQLNAAECLKNLSPSAGLIQDNDSLNGSY
LDPNYQSIKWQPHQQNKWATLYDANYKELPMLTYRVDADKGFNFSVGDDAFVCQKKNHFQ
VTVYIGMLGDPKYVKTPEGLKPLECFYLKLHGVKLEALNQSINIEQSQSDRSKRPFNPVT
VNLPPEQVTKVTVGRLHFSETTANNMRKKGKPNPDQRYFMLVVALQAHAQNQNYTLAAHI
SERIIVRASNPGQFESDSDVLWQRAQLPDTVFHHGRVGINTDRPDEALVVHGNVKVMGSL
MHPSDVRVKEDIQEVDTTEQLKRISRMRLVHYNYTPEFAATVGIDNTSETGVIAQEVKEI
LPEAVKDTGNLVFSNGKTLENFLVVNKERIFMENVGAVKELCKLTDNLETRIDELERWSH
KLAKLKRLDSMKSTVSSGAFSQTGSQFSRAGSMPHKKRPHKIASKSPSVVPEQACISQRF
LQGTIIALVIIMAFSVVSMSTLYVLSLRSEEDLVDIEGSFAVPTACLLALFRHRGPGVPV
ALCPRSSQNIDKTQMVRSTAASDRASSRTPTHHVTSNVLDLLDALPGHSVLACFNPPCFS
TCCSAAPTNASSVALSEASPTHVTNQTGKSHPSRNQSQTSLQPVTNIKAKSRGITRKTTS
YTKWPKTPDRSQSFGSPNASPSSPFTHLQGKSKYISNLSLSRSNSPLGQARPQRSIRQLI
AHLPPTGPSPVLRSIRILEIDMAIQSQFCAASNACRTGNFTYRIPISQLTAVNTNLTLEM
NSSSVLSISLCGLVSSDPCQDVASTDGFSDGTDTQETTHRWPLVMLSFREFTYHFRVAQT
GRANCSTTPEQMGHLFTDYYFQFYWLCE
Download sequence
Identical sequences G1MZU8
ENSMGAP00000004608 ENSMGAP00000004608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]