SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004817 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004817
Domain Number 1 Region: 242-478
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.71e-57
Family DBL homology domain (DH-domain) 0.0000259
Further Details:      
 
Domain Number 2 Region: 476-604
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-37
Family Pleckstrin-homology domain (PH domain) 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004817   Gene: ENSMGAG00000004935   Transcript: ENSMGAT00000005539
Sequence length 1060
Comment pep:known_by_projection chromosome:UMD2:Z:26980732:27016687:-1 gene:ENSMGAG00000004935 transcript:ENSMGAT00000005539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERAYSLPEHSREKRIQEEEWDKYIVPSKTESEKYKVSRTFSFLMNRMTSTRNKYKKDRSL
FITKAQSMSLHGFHKKIQTLILVCLWCVFLDKVCWPKCQCKQCHYDVSRGNKCFEKSQER
YHSKNKPQVGIGRSHGNDNANIPVYIYTEMSLGLGCDVRLFVTEDCFLPYPHQSYSTLLW
VLSLYSVXSFSKQRRIKGFNLRKDFFCSFSSLTVTLAFQHFVEVDSSQWTDISSDAQEFE
AESWSLVVDPMFCNKQEKDVAKRQDVIFELMQTEVHHIHTLFIMSEIFRKGMKEELQLDH
STVDRIFPCLDELLEIHRQFFCRMRERRQESCEEGNERNFVISRIGDILVQQFSEENATK
MKKIYGEFCSHQKEAVNLFKELQQNKKFQNFIKLRNSNLLARRRGIPECILLVTQRITKY
PVLVERILQYTKEGSEEHKDLCRALRLIKDIIAAVDLKVNEYEKRQKLMEILNRTENKTY
TKLKSGHIFRKQDLMGKERILLHEGLVYWKTATGRFKDTLALLLTDMLLFLQEKDQKYIF
AAVDQKPSVISLQKLIVREVANEERGMFLISASSAGPEMYEVHTNSREERNSWMRHIQDA
VESCPEEQEEGKMGEYDEDRRIAEAKACKIQKCQESLSNQDQQICSCLEDKLHIYAELVD
MSGFEDVHVEPHLLIKPDYGETPQAASLLVAALKEVESLHVAVMSSQVNETDRLSEESTE
ESLLLSFAANSHILKIIPIISSVSGGKDFGKGWSPVTQGFIQVLNHIDLTEGGGSMSFPG
STGTEIVQAIQNLTRLLYSIQAALAIQDSHRELHRLLLQENEKTSRSHSSWIPLFLEPEK
YRNSEKQREELANINKLQQQFQQEQQRWLRECEQWQQEQEVRAGLLEQREQACSCQEELL
EKSRQGLALQLQEFQQSLERLQEGQKVLEKKRDSIKVQKKLLWHWKHGLQSNLLLPTGSR
EMVIDRLDSLHDENAFYLNEAVVRVSLSGLNRSDSSLIYEDVVYGLGISNSDMARTCENQ
VDFRVDTSCQPALTNELWKSTGPYQQMSFSCKSNKDAFNN
Download sequence
Identical sequences G1N0A3
ENSMGAP00000004817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]