SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004833 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004833
Domain Number 1 Region: 142-459
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.18e-123
Family Transglutaminase core 0.00000000388
Further Details:      
 
Domain Number 2 Region: 5-141
Classification Level Classification E-value
Superfamily E set domains 9.45e-40
Family Transglutaminase N-terminal domain 0.0000936
Further Details:      
 
Domain Number 3 Region: 494-605
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.93e-25
Family Transglutaminase, two C-terminal domains 0.00034
Further Details:      
 
Domain Number 4 Region: 607-705
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.56e-25
Family Transglutaminase, two C-terminal domains 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004833   Gene: ENSMGAG00000004893   Transcript: ENSMGAT00000005555
Sequence length 707
Comment pep:known_by_projection chromosome:UMD2:22:7200249:7210965:1 gene:ENSMGAG00000004893 transcript:ENSMGAT00000005555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLAQKITNIDWHSKLNKAAHHTSDYNSMQVILRRGQAFTITLNFQTTVQPEDNFTFIAST
GLSPAESQQTKAIFHLSEDAASGWSATQEHCEPGRMSLIIVSPANAIIGRYKLKLQIASG
NKTSSALLGQFVLLFNPWCPNDDVYMANENERQEYVLNDSGIIFQGKEKYIQQEAWNYGQ
FEEDILDISLSILDRSLNHRQDPSTDVSNRNDPIYVCRVISAMVNSNDEKGVVEGKWSGN
YRSGTNPLHWSGSVTILRKWYRGRYKPVRYGQCWVFAGVMCTVLRSLGIPTRVITNFNSA
HDSNINLSIDKYIDVSGNTLNLTEDSVWNFHVWNESWFTRRDLGSFYDGWQVLDATPQEK
SKGIYRCGPASTRAIKEGDVNLDYDSSFVFAAVNADCVTWIQHSNKRKERIYSNTRKIGK
FISTKAVGTNTRVDITDNYKYPEAGSSKERQVYKKALKLLAVRNTGKRKKVTKPTRRFPV
ARRQNMRATTRKPTVSGKLKLDASTVIGQDILLTLALQNLTAEFKTMKVKLKASAVLYTR
KPKAEILQWSRTVQLGSEEVKEISFKITYSQYKNALLDDRKILVTAVCEDRQGASLLLEK
DIVLQDPLLTIEVLGPTVVHKATNVLVTFTNPLSEVVTDCVLRAEGSGLLKEQLNINVAR
MAPMETSTAEFEIIPYKSGIRQLQVDLACIRFSNIKGFVMLDVAPAQ
Download sequence
Identical sequences G1N0B6
ENSMGAP00000004833 ENSMGAP00000004833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]