SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004952 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004952
Domain Number 1 Region: 150-465
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.29e-120
Family Transglutaminase core 0.00000000149
Further Details:      
 
Domain Number 2 Region: 8-148
Classification Level Classification E-value
Superfamily E set domains 6.65e-36
Family Transglutaminase N-terminal domain 0.0001
Further Details:      
 
Domain Number 3 Region: 473-586
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.02e-30
Family Transglutaminase, two C-terminal domains 0.0000326
Further Details:      
 
Domain Number 4 Region: 588-686
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.92e-25
Family Transglutaminase, two C-terminal domains 0.0000892
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004952   Gene: ENSMGAG00000005069   Transcript: ENSMGAT00000005677
Sequence length 690
Comment pep:known_by_projection chromosome:UMD2:22:7165878:7176203:1 gene:ENSMGAG00000005069 transcript:ENSMGAT00000005677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAETLTQPSTDWHVKENGRDHHTSKFSTKELIVRRGQAFVITFNGTEQPEQKVTASWKEK
SCLFSLKGPKPSKQAKTQATFGISSTASKEGWSAVLQSTSSHSVSISISSPANAVIGRYK
LSVQSTSTGSSSPVVLGTFVLLFNPWSSGDDVFMPNKAECEEYVLEEFGIIFAGNSNHIN
SFGWNFGQFQADILNICLSMLDRSLNYRKDPATDVSHRYDPKYLGRVLSAMVNANDDQGV
VLGNWSGNYDGGKSPSSWTGSGEILQNWKKSGFKPVRYGQCWVFAAVLTTVLRCLGIPTR
TITNFSSAHDADGNLRVDEFYDASGNHLNEGADSVWNFHVWNESWFSRKDLGPSYSGWQI
LDATPQEESGGIYQCGPASRNAIKEGDVDLDYDCPFVFAEVNADCMYWNYDPATRKKTLL
FNKSTVIGQLISTKAVGRNDRIDVTSDYKYEEGSKKERDIFKKAPPTPKEIEQKPDISGK
FKMAGPLEVGKDLNLILVLTNLQSEVKSVQVNMTAWSTLYTRRPVREIWKDSLSVSLSPE
EEKQFPIKISYAEYQQQLTTDNAIEVTALCHVEGGIQVLVQRHIALDNPAIDIQVLGEAK
VNKEVEVEVVFTNPIDTEVKDCVLQVEGSDLLRGILMIDVPPLKGKEISSTKFKLTPFET
GSKHLLVNFSCDKFADIKAFKTVKIQSLIQ
Download sequence
Identical sequences G1N0J9
ENSMGAP00000004952 ENSMGAP00000004952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]