SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004996 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004996
Domain Number 1 Region: 339-631
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.98e-74
Family Protein kinases, catalytic subunit 0.00000000271
Further Details:      
 
Domain Number 2 Region: 56-131
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.44e-26
Family Ras-binding domain, RBD 0.0000191
Further Details:      
 
Domain Number 3 Region: 131-184
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000105
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004996   Gene: ENSMGAG00000005082   Transcript: ENSMGAT00000005721
Sequence length 647
Comment pep:known_by_projection chromosome:UMD2:14:5057791:5077744:-1 gene:ENSMGAG00000005082 transcript:ENSMGAT00000005721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHIQGAWKTISNGFGLKDSVFDGPNCISPTIVQQFGYQRRASDDGKISDTSKTSNTIRV
FLPNKQRTVVNVRNGMTLHDCLMKALKVRGLQPECCAVFRLVTEPKGKKVRLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSNISDSGVPALPPLTMRRMRESVSRIPVSSQHRYSTPHVFTF
NTSNPSSEGTLSQRQRSTSTPNVHMVSTTMPVDSRIIEDAIRNHSESASPSALSGSPNNM
SPTGWSQPKTPVPAQRERAPGTNTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSILWMAPEVIRMQDSNPFSFQSDVYSYGIVLYE
LMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCLKKVREERPLFP
QILSSIELLQHSLPKINRSASEPSLHRASHTEDINSCTLTSTRLPVF
Download sequence
Identical sequences G1N0N1 P05625
9031.ENSGALP00000033314 ENSMGAP00000004996 ENSMGAP00000004996 ENSGALP00000033314 ENSGALP00000007991 NP_990638.1.86415 XP_010716739.1.16129 XP_015148499.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]