SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005028 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005028
Domain Number 1 Region: 22-233
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-54
Family DBL homology domain (DH-domain) 0.00019
Further Details:      
 
Domain Number 2 Region: 225-322
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000455
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 3 Region: 678-800
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000883
Family WD40-repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005028   Gene: ENSMGAG00000005143   Transcript: ENSMGAT00000005754
Sequence length 806
Comment pep:known_by_projection chromosome:UMD2:8:12970876:12980222:-1 gene:ENSMGAG00000005143 transcript:ENSMGAT00000005754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAPEGTSRCPCCHPDFIWVFSPPVQDMRKHVIMTLLDTEQSYVESLRTLMQGYMKPLKQP
ENSLLCDPSLVDEIFDQIPELLEHHEQFLEQIHDCVQNWHEKQKVGDLLVQSFSKDVLVN
IYSAYIDNFLNAKDAVRIAKEARPAFMKFLEQSMRENKEKQALSDLMIKPVQRIPRYELL
VKDLLKHTPEDHPDHPFLIDAQRNIKQVAERINKGMKSAEEVERNARIVQEIESHIEGME
DLQAPLRRFLRQEMVVEVKAVGGKKDRSLFLFTDLLVCTTLKRKSGSLRRSSMSLYTAAS
VIDTASKYKLLWKLPLEDVDIIKGASQATNRESIQKSICRLDEDLSTLGQVSKLSETLSF
PHQSLDDVIKDLMAAIHRELAEKQSLSFSMAFPPTKELSAAKADGTESFIFEFPNPDARL
GFEQALEDAKKKLASSKNCLDPEFLKAIPIMKTRSGMQFSCASPSHSSPENAHEVWVCNS
DGYVGQVCLLSIRKEPIVEACIAVCSARILCIASVPGLKRPYSRERTEPMVSPSSEPAPT
QSEDSGPQQCLHISISGSSLELSEPVDSTHRELVPFDSDDTDDESSPSPSGTLQSQASHS
TISSSFGNEEIPSCKEAAAETTSSEEEQEPGFLPLATAFGQSRRGESPNRWTARRSSRGS
FTRGSLEDLLSLDPEAYQSSMWLGTEDGCIHVYQSSDNIRNRKNSMKMQHAASVMCILYL
DNQVFVSLANGELIVYQREPGRFWDPQNSKSLSLGSPGSPITKMVAVAGKLWCGCQNRVI
VLNTATLEQEHTLQVGQDSGRSVSCM
Download sequence
Identical sequences G1N0Q6
ENSMGAP00000005028 ENSMGAP00000005028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]