SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005054 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005054
Domain Number 1 Region: 249-401
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.2e-35
Family DBL homology domain (DH-domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 54-113
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000135
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005054   Gene: ENSMGAG00000005175   Transcript: ENSMGAT00000005780
Sequence length 401
Comment pep:novel chromosome:UMD2:30:3419896:3438425:-1 gene:ENSMGAG00000005175 transcript:ENSMGAT00000005780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFRNEDSGKSEKAEKGTKVMRRLSSLRSRVTGSWQKDKGKNKEQSKEKEKETKEPKESWK
EVNRHQLVPGVFSSGTSCSLCAKPLGNKSGLQCLNCAVNVHKNCKSLLAECSSIRTKHRP
SGPTQSADFARQPLLVFCGQKQKMEEQPRSLLLGPDGTPALPRNLGMTIAQRGNSPSSLN
TAGAVSKFGLISGDMDEGDSGFIKFKQTSDDVVSLAPSTADCIFLEGLDAYSLSLRSEIE
TDAHEFEAESWSVAVEQPYAKKQKKEVVKRQDVIYELMQTEMHHVRTLKIMLKVYSKAMK
EELQFSNAVINKLFPCVDELLEMHGQFLLQLKERRKESLEEGSDRNYIIQNIGDLLVKQF
SGENGERMKEKYGVFCSGHNEAVSHYKDLLQSHKKFQNLIK
Download sequence
Identical sequences G1N0S5
ENSMGAP00000005054 ENSMGAP00000005054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]