SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005140 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005140
Domain Number 1 Region: 354-616
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.93e-79
Family Protein kinases, catalytic subunit 0.00000000215
Further Details:      
 
Domain Number 2 Region: 4-147
Classification Level Classification E-value
Superfamily PH domain-like 7.12e-47
Family Pleckstrin-homology domain (PH domain) 0.0000309
Further Details:      
 
Domain Number 3 Region: 234-385
Classification Level Classification E-value
Superfamily SH2 domain 3.77e-30
Family SH2 domain 0.0000077
Further Details:      
 
Domain Number 4 Region: 175-255
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-19
Family SH3-domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005140   Gene: ENSMGAG00000005218   Transcript: ENSMGAT00000005871
Sequence length 623
Comment pep:known_by_projection chromosome:UMD2:15:11013262:11040726:-1 gene:ENSMGAG00000005218 transcript:ENSMGAT00000005871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNCVLLEEQLIKKSQQKRRTSPSNFKVRFFVLTKSKLAYYEHRHGKKKTLKGSVELSRI
KCVEIVKSDIIIPCQYKYPFQIVHDNYILYVFAPNRESRQRWVFTLKEETRSNNSLVSKY
HPDFWIDGKWRCCAQTEKMAVGCIEYDPTKTASKKPLPPTPEDNWKSLLNTKETLVMAIY
DYEAQNPQELTLQYNEEYHVIDSSEEHWWLIQDKNGHEGYVPSSYLAEKSPDNLQIYEWY
NKNISRSKAEMLLRDEGREGAFMVRDSRQPGMYTVSVFTKALSTDNNPVIKHYHINETTD
FPKRYYLAEKHVFDCIPELINYHQHNAGGLVTRLRYAVSSWKKKAPITAGLSYESTGKLV
INPSELTRVQEIGSGQFGVVYLGYWLEKTKVAIKTIREGAMSEEDFIEEAKVLMKLSHPK
LVQLYGVCFENTPICLVFEFMEHGCLSDYLRSQRGSFSKETLLGMCLDVCEGMAYLEQNS
VIHRDLAARNCLVGESHVVKVSDFGMSRIVLDDQYTSSTGTKFPVKWSAPEVFSYSNYST
KSDVWSFGVLMWEVFSEGKMPYENRTNGEVVEEINAGFRLYKPKLASKSIYEVMSHCWSM
RKEDRPSFSLLLYQLSEISEFDL
Download sequence
Identical sequences G1N100
ENSMGAP00000005140 ENSMGAP00000005140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]