SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005297 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005297
Domain Number 1 Region: 7-204
Classification Level Classification E-value
Superfamily E set domains 8.68e-83
Family RhoGDI-like 0.00000000793
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005297   Gene: ENSMGAG00000005399   Transcript: ENSMGAT00000006030
Sequence length 204
Comment pep:known_by_projection chromosome:UMD2:20:5119410:5123274:1 gene:ENSMGAG00000005399 transcript:ENSMGAT00000006030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGAVT
VTADPNAPNVVVTKLTLVCTTAPGPLELDLTGDLESYKKQAFVLKEGVEYRIKISFRVNR
EIVSGLKYIQHTFRKGVKIDKTEYMVGSYGPRAEEYEFLTPMEEAPKGMLARGSYNIKSK
FTDDDKTDHLSWEWNLTIKKEWKD
Download sequence
Identical sequences A0A226N0R6 F1P3P3 G1N1C7
ENSMGAP00000005297 ENSGALP00000013738 ENSMGAP00000005297 XP_010719649.1.16129 XP_015150910.1.86415 XP_015735378.1.68032 9031.ENSGALP00000013738 ENSGALP00000013738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]