SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005364 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005364
Domain Number 1 Region: 1131-1433
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.79e-91
Family Complement components 0.0000112
Further Details:      
 
Domain Number 2 Region: 1555-1688
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.7e-34
Family Alpha-macroglobulin receptor domain 0.0012
Further Details:      
 
Domain Number 3 Region: 1723-1771
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000018
Family Ovomucoid domain III-like 0.019
Further Details:      
 
Domain Number 4 Region: 797-903
Classification Level Classification E-value
Superfamily E set domains 0.000000000154
Family SVA-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005364   Gene: ENSMGAG00000005382   Transcript: ENSMGAT00000006097
Sequence length 1772
Comment pep:known_by_projection chromosome:UMD2:30:3558953:3593623:1 gene:ENSMGAG00000005382 transcript:ENSMGAT00000006097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGGAPPSPKAPLIEAERGVQRAEPLSRGYLIAAPSVFRSGVEEAVSVTIFNAVKETTVQ
IQLVVKGETVSRGHGTVLDKGTIKLKVPSGLRGQGHLKVWGNRHVTEEGYIFHNYTTVTI
DSKGSSVFIQTDKPVYKPKQKVLINLFTVTSDLRPFNDRIEAYVVDPRGSRMIEWSNLKP
FCCGMVNMSFPLSDQPVFGEWLIFAEMQGHTYNKSFEVQKYVLPKFELLIDPPRYIRDLT
TCEKGTVHARYTFGKPVTGRLIVNMTINGVGYYRHEVGHPVLKTTQIDGSAVFDVCVKDM
MPADVPEHFRGTVNIWATVVSSDGSKQVTFDDSTPVQKQLIDIKYSKDTRKQFKPGLPYK
GKVEVTYPDGSPADRVTIRIKAELTPKDNVYTSELVSRNGLVEFEIPSIPTAAQYVWLET
KVTAIDGRPSGDQYLPNYLSISSWYSPSKCHIQLQAPDKPFQVGEEAWIAVKSTCPCNFT
LHYEVASRGNIVLSGLQPSNITQQRSKRATIPFEKNMDVTHFPGAAPTDTPATEVEVCVT
FLHFSVSHSMAPLGRLLVYYVRENGEGVTDSLQFSVKSTFENQVAVTLSANETRPGDVVN
IKVRAAKSSCVCIATVDKSVYLLKTGFQLTASQVFKELAEYDVSDAFGAPKEEGHFWWPG
MSSRRRRRSSVFPWHWDVTKDARFAFTETGLVVMTDTVSLNHRQNGGMYTDEAVPAFQPH
TGTLVATMRSKMAQSRAEKRKRTFFPETWIWHCLNVSNTSGEAELHVEVPDSITTWITEA
VGLSEEEGLGIANQTELKTFKPFFIDFTLPYHVIRGEQTKIPLTVYNYLSVCVEVHVKIS
VPKGIKFVGHPGKHHLTRKKCVAPGEAKPTSVVLSFSELGLSNITAKAFAYGGTNCCQNG
MQTLKNGKHSEDNYVDKRTPVGVDYVRSSVVIEPEGLSREYTYSVFFCPNEKIHISTPNK
YEYQYMQKPAQMTHFDIAVKAHNDAHVALSSGPHDMAEMTEIVIGGHQNTKTWISISKMG
EPVVSRDTAGILSWDEFRSFWISWKNGIIQVGHGTRVLNESIIVEWTVPKQFEVKYIGFS
TGWGSIGEFKIWRKEETDENHNEAFTLGVPHNIIPGSERATASIIGDVMGPTLNNLDNLL
RLPFGCGEQNMIHFAPNVFVLKYLQKTKQLSQEVESEATDYLVQGYQRQLTYKRQDGSYS
AFGERDSSGSMWLTAFVLKSFAQSRGFIFIDPKELTAAKEWIIQHQKEDGSFPAMGRILN
KDIQGGIHGKISLTAYVVASLLETGVTSEEERSAVDKAKHFLEANLHSAEDPYATALTAY
ALTLLHSPSAAVVLRKMNSMAITQDGFTHWSLTGSLVADEDTFMGFNDGLSQSVVSAEVE
MTSYALLTYTLLGDVASALPVVKWLSQQRNALGGFSSTQDTCVALQALAEYAILSYVGGV
NLTISLASTNLDYQETFELNKMNKKVLQTAVIPSIPTGLFVSAKGEGCCLMQIDVTYNVP
DPIAKPAFQLLVNLKEPKSEQHLQAPVLLRSLSPDENRSETFHRERAVVDDDDPAADRDH
QEYKVILETCTRWLHSGSSNMAVLEVPLFSGFRADIESLEQLLMNKQIGLKRYEVDGRKV
LFYFDEIPSQCMTCVKFQAFREYIVGKTAPVPIKVYDYYEPAFEATRFYNVSENSPLARE
LCDGPTCNEVESSASQWAVYFAGFSHSGPCNNIFGCLEDEYFEQCMCSRDCGYDGDPVCG
SDGQIYQNHCQMEVASCRNNTRIEQIPMSQCS
Download sequence
Identical sequences G1N1H6
ENSMGAP00000005364 ENSMGAP00000005364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]