SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005430 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005430
Domain Number 1 Region: 204-472
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-84
Family Protein kinases, catalytic subunit 0.000000000128
Further Details:      
 
Domain Number 2 Region: 95-235
Classification Level Classification E-value
Superfamily SH2 domain 7.81e-38
Family SH2 domain 0.00000134
Further Details:      
 
Domain Number 3 Region: 35-120
Classification Level Classification E-value
Superfamily SH3-domain 3.81e-20
Family SH3-domain 0.0000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005430   Gene: ENSMGAG00000005488   Transcript: ENSMGAT00000006163
Sequence length 1090
Comment pep:known_by_projection chromosome:UMD2:19:6106241:6169167:1 gene:ENSMGAG00000005488 transcript:ENSMGAT00000006163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALQRPVVSDFEPQGLSEAARWNSKENLLSCPSENDPHLFVALYDFVASGDNTLSITKGEK
LRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGING
SFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVAD
GLITTLHYPAPKRNKPTIYGVSPNYDKWEIERTDITMKHKLGGGQYGEVYEGVWKKYSLT
VAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYL
RECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRL
MTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQ
VYELLEKDYRMERPEGCPEKVYELMRACWQWSPSDRPSFAEIHQAFETMFQESSISDEVE
KELGKKGMRSVVSNFLQAPELPTKTRTSRRAAESKDVNEGLETAHARGQGECDPLDHEPA
VSPLLPRKERVALESSLNEDERLLPKDKKPNLFSALIKKKKKTAPTPPKRSSSFREMDGH
SDRRAGGEEECRDAGNGAFIAPPTEAADPSKFQSPSNGAGVTNGVVAGNSGFLSPHLRKK
SSTMSSSRGVAGEEESSSNSSKRFLRSCSASCVPHGAKDTEWKSVTLPRDLQSTGRQFDS
STFGGHKSEKPALPRKRANEAKTDIAVRGTVTPPPRLLKKNEETTDDVFKDAESSPGSSP
PTLTPKLGRRQPAVPPSSSVLHKDDGVKSSALGTTATMDQGSAAKPNSAAFAGANKASVE
EPRLRRLKQTSELAGKDKGKLSKLKPAPPVPMSSSSVGKPGKVSHSPSHEAATDVVSGPK
SKQLTQVADAVSSEAVKPNQSGEGVKKLGIPSVPKPQSSTKLLMSTATSAASSSSVPSAP
AFIPLISTRVSLRKTRQPPERIASGTITKGVVLESTEALRLAISKNSEQMASHSTVLEAG
KNLYTFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGSGSAATQDFSKLLSS
VKEISDIVQR
Download sequence
Identical sequences G1N1M4
ENSMGAP00000005430 ENSMGAP00000005430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]