SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005527 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005527
Domain Number 1 Region: 110-366
Classification Level Classification E-value
Superfamily Caspase-like 2.84e-85
Family Caspase catalytic domain 0.0000000278
Further Details:      
 
Domain Number 2 Region: 1-57
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000612
Family Caspase recruitment domain, CARD 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005527   Gene: ENSMGAG00000005586   Transcript: ENSMGAT00000006264
Sequence length 369
Comment pep:known_by_projection chromosome:UMD2:23:5115029:5120037:1 gene:ENSMGAG00000005586 transcript:ENSMGAT00000006264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REQARQLVIDLETRGKQAFPIFLSILRETGHDDLADMLDEGCGSPISPPVDLRPVQLELP
GERRDKSVSTAERLSIPVQAESQRFQMPPAPAHGKDCPGALREVWCTSCEQPCGHCLIFN
NVNFSRDSDLSARAGSDIDCEKLEKRFKSLCFHVRTLRNLKAQEIDLELRKLARLDHSTL
DCCLVVILSHGCQTSHIQFPGGIYGTDGKTIPIEKIVNYFNGSQCPSLRGKPKLFFIQAC
GGEQKDQGFEVGCESPQDETCRGSVESDAIPFQAPSGSVDEPDAVASLPTPGDILVSYST
FPGFVSWRDKVSGSWYVETLDDVLEHYARSEDLLTMLLRVSDIVSTKGKYKQIPGCFNFL
RKKFFFLCK
Download sequence
Identical sequences G1N1U4
ENSMGAP00000005527 ENSMGAP00000005527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]