SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005585 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005585
Domain Number 1 Region: 158-361
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.19e-57
Family DBL homology domain (DH-domain) 0.00022
Further Details:      
 
Domain Number 2 Region: 344-496
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-32
Family Pleckstrin-homology domain (PH domain) 0.0026
Further Details:      
 
Domain Number 3 Region: 456-495,531-595
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.25e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.002
Further Details:      
 
Domain Number 4 Region: 622-718
Classification Level Classification E-value
Superfamily PH domain-like 6.56e-19
Family Pleckstrin-homology domain (PH domain) 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005585   Gene: ENSMGAG00000005647   Transcript: ENSMGAT00000006323
Sequence length 732
Comment pep:known_by_projection chromosome:UMD2:14:6938854:6979957:-1 gene:ENSMGAG00000005647 transcript:ENSMGAT00000006323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVASSGCSTNEKSEADENEPDVPCGADLSNTDIMKIKELSIGDNKSHEDCTAVNVSKEPS
RELSSKDSTAELNGNGKIPNRDSGIDSPSCSVAGETFPNEEGAEQKKPSVSGNPGEMEQK
RDSTQDEDSDIDEGSSEEQETAEVPKLEYMDINKCTEPQKLFNIANELLHTEEAYVKRLH
LLDQVFCTKLSEAGISSEVITGIFSNISSIYCFHGQFLLPELKTRITQEWSVNPRLGDIL
QKLAPFLKMYGEYVKNFDRAMDMVNTCMQRSSPFKDVVQNIQKQEVCGNLTLQHHMLEPV
QRIPRYELLLKDYLKKLPEESPDRKDAEKSLELISTAANHSNAAIRKMEKMHKLLEVYER
LGGEEDIVNPANELIKEGHIQKLSAKNGTAQDRYLFLFNSMVLYCVPKLRLIGQKFSVRE
KMDIGGLQVQEIAKQNVAHTFSITGKKRSLELQARTEEEKREWIQVIQATIEKHKQNSET
FRAFNSSFSQEEEHLPDSSIASTSSVESMPGADSGAFGGSDSCRKFSKSKRDKEKQACKS
CSESFNSITKRRHHCKQCGAVICAKCSEFKPLADNSRHNRVCKECFLQLPLSPCSPGMEA
VGEQKKRQAAEKQSLLAPENSLFSSYLQFLEKGKTWYKMWVTIPKTEPLVLYLQGINQDG
RGPRPIPLPGYEVSFPGSGEKFEVKHVFKLCQSQQTIYFSAEDEELQLKWMEILAKAAKG
ETEDVAEGLSNP
Download sequence
Identical sequences G1N1Y7
ENSMGAP00000005585 ENSMGAP00000005585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]