SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005625 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005625
Domain Number 1 Region: 110-322
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.07e-60
Family DBL homology domain (DH-domain) 0.00000000335
Further Details:      
 
Domain Number 2 Region: 307-461
Classification Level Classification E-value
Superfamily PH domain-like 1.55e-47
Family Pleckstrin-homology domain (PH domain) 0.0000000581
Further Details:      
 
Domain Number 3 Region: 23-119
Classification Level Classification E-value
Superfamily SH3-domain 7.35e-20
Family SH3-domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005625   Gene: ENSMGAG00000005674   Transcript: ENSMGAT00000006365
Sequence length 528
Comment pep:known_by_projection chromosome:UMD2:9:11671922:11728765:1 gene:ENSMGAG00000005674 transcript:ENSMGAT00000006365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCQGNKLLLTLGFLFPKLISGGSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWW
WGQIDDEEGWFPASFVRLWVNQEDGVEEGTSEVQNGHLDPSADCLCLGRTVQNRDQMRAN
VINEIMSTERHYIKHLKDICEGYLKQCRKRRDMFSDEQLKIIFGNIEDIYRFQMGFVRDL
EKQYNNEDPHLSEIGPCFLEHQDGFWIYSEYCNNHLDACMELSKLMKDSRYQHFFEACRL
LQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTAQDHSDYRYVAAALAVMRNVTLQINE
RKRRLENIDKIAQWQASVLDWEGDDILDRSSELIYTGEMSWIYQPYGRNQQRVFFLFDHQ
MVLCKKDLIRRDILYYKGRIDMDKYEVVDIEDGRDDDFNVSMKNAFKLHNKETEEMHLFF
AKKLEEKLRWLRAFREERKMVKEDEKIGFEISENQKRQAAMTVKKVSKQKESRYSKIPTY
PPPQDPLNQGQYMVTDGISQSQVFEFTEPRRSQAPFWQNFSRLTPFKK
Download sequence
Identical sequences G1N216
ENSMGAP00000005625 ENSMGAP00000005625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]