SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005871 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005871
Domain Number 1 Region: 570-629
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000541
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0031
Further Details:      
 
Domain Number 2 Region: 645-765
Classification Level Classification E-value
Superfamily PH domain-like 0.000000166
Family Pleckstrin-homology domain (PH domain) 0.04
Further Details:      
 
Domain Number 3 Region: 817-1050
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000504
Family WD40-repeat 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005871   Gene: ENSMGAG00000005891   Transcript: ENSMGAT00000006615
Sequence length 1295
Comment pep:novel chromosome:UMD2:2:11997300:12064188:1 gene:ENSMGAG00000005891 transcript:ENSMGAT00000006615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLSDRSCLRLTAGPPSMDLDANIQRTLEDSLATEAYERRIRRLEQEKLELSRKLQESTQT
VQALQYSTVDGPIAASKDLEIKSLKEEIEKLKKQVTGKIQLNTQYFSNSYYKREVFQVDQ
ALPENFHLYYLGFFPLNNVVQEMEHLFAYFCNIKSHCCPFTILLAFYAKGEVVPGGEITK
VNMRNEDISLVVFLRFVCKMLERVLKTITAFKLQNDKSTVQIYDEQIFRKQKQIGRSPGV
SSIEHQQEITKLKADLEKKSVFYEEELSKREIMHANEIKSLKKELRDAESQQLALKKEIM
ILKDKLEKTRRENQSEREEFETEFKQKYEREKILLTEENKKLSNELDKLTTMFERLSMNN
RQLEEEMRDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQALASKMTEELEALRNSSL
GARATDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQDELNKVKASCISTECKLQES
EKKNLELLSDIERLKKETEELRSEKGVKHQDSQNSFLAFLNAPTSALDQFERSPSCIPAN
KGRRVTDHPPRSIHTPTMRTAYIGSGLSAPKPKAHQFVVKSFNTPTKCNQCTSLMVGLIR
QGCTCEEVCGFSCHVTCADKAPAVCPIPPEQTKGPLGIDPQKGIGTAYEGHVRVPKPAGV
KKGWQRALAVICDFKLFLYDIAEGKASQPSVVVSQVIDMRDEEFSVSSVLASDVIHANRK
DIPCIFRVTASQLSATSNKCSILILTDGENEKSKWVGVLNELHRILKKNKLKDRSVYVPK
EAYDSTLPLIKTTQSAAIIDHERIALGNEEGLFVVHVTKDEIIRVGDNKKVHQIELIPSE
QLIAVISGRNRHVRLFPMTALDGRETEFYKLAETKGCQSIVSGHVRHGALTCLCVAMKRQ
VLCYELNQSKTRHKKIKEIQVQGNVQWMSIFSERLCVGYQSGFLKHPLHGEGSPYSLLHP
DDHTLSFISQQPTDAICAVEISNKEYLLCFSSVGVYVDCQGRRSRQQELMWPATPSSCCY
NAPYLSVYSENAIDIFDVNSMEWIQTIPLKKVRPLNTEGSLNLLGLETVRLIYFKNKMAE
GDELVVPETSDNSRKQMVRNINNKRRYSFRVPEEERMQQRREMLRDPEMRNKLISNPTNF
NHIAHMGPGDGIQILKDLPMNLRPQESRTVFSGSVSIPSITKSRTEPGRSMSASSGLAAR
SSAQNGSALRREFSGGSYGAKRQPMASPSDGSLSSGGLDQGSDAPTRDYEREDSDSPRHS
TASNSSNLSSPPSPVSPHKTKSLSLESSDHVSWDS
Download sequence
Identical sequences G1N2K1
ENSMGAP00000005871 ENSMGAP00000005871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]