SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005921 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005921
Domain Number 1 Region: 45-185
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000246
Family Phosphotyrosine-binding domain (PTB) 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005921   Gene: ENSMGAG00000005968   Transcript: ENSMGAT00000006666
Sequence length 208
Comment pep:known_by_projection chromosome:UMD2:11:9575938:9621423:-1 gene:ENSMGAG00000005968 transcript:ENSMGAT00000006666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QHFQTMLKTKLNVLTLRKEPLPTVIFHEPEAIELCTTTPLMKTRAHTGCKVTYLGKVSTT
GMQFLSGCTEKPVIELWKKHTLAREDIYPANALLEIRPFQVWLHHLDLKGEATVHMDTFQ
VARIAYCTADHNISPNIFAWVYREINDDLSYQMDCHAVECESKLEAKKLAHAMMEAFKKT
FHSMKSDGRIHRNSSSEEVSHGFESDDG
Download sequence
Identical sequences G1N2P1
ENSMGAP00000005921 ENSMGAP00000005921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]