SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006070 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006070
Domain Number 1 Region: 1219-1358
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.98e-32
Family Synaptotagmin-like (S variant) 0.064
Further Details:      
 
Domain Number 2 Region: 2035-2168
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.78e-22
Family Synaptotagmin-like (S variant) 0.017
Further Details:      
 
Domain Number 3 Region: 1085-1144
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000284
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006070   Gene: ENSMGAG00000006055   Transcript: ENSMGAT00000006816
Sequence length 2209
Comment pep:known_by_projection chromosome:UMD2:12:7877445:8018754:-1 gene:ENSMGAG00000006055 transcript:ENSMGAT00000006816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSSCLKSLISSYIYKICKGMFTKKLGNSTKRKESCQSKKEQDLTPTGQTKNPKFSNTLK
STVKKIAKCPSARNLSTEEEESNREFSLSPTFSYRVAIANGLQKHVFVTNNNNEDLTQDL
SSNDSSYSDSLSEVKSNSKKNEYFSHTMPVRRNRKSLSSLAASDGSSDGERTLHTLKLGA
LRKLRKWKKSQECVSSDSELSTWKKTWGLRSKSLDRTGRHQKSNTLEPGFSSTGCISQTH
DVMEMIFKELQGISQIETELSELRGHVNALKQSIDEISSSVEVVQNEIEQLRTGFVQSRR
ETRDIHDYIKQIGHPGNKASLRFLNVPEERLEKTENIVYKILIEKMGFSEAQSTIKIEFA
QRLGQQRDCPNAKPRPILVYFESSQQRDLLLKKSYKLKGTGIGISTDVFSHDIKEKERGL
PSSQTYESMDMKILPVETKTKMHDWESPDSDKDMESDINKNSYAKVSKSALQIKASTTKG
NVESPDHKDLSRTADNNTFSNRRNYESQSPEFDNVEKQPKMYYSDMTPLWHLQNDFAAPK
LSRSESDFSKLCQSYSEDFSENQYFSKTNGSSLLSSSDRELWQRRQDDSANWYGSSQEQT
FAQDAQQYTEQNEVENTETVDSGLSNGIMCVSRDRSHYSDSQLSLHGDFSPWKDWNQLEQ
GADLGLDSSTQEVFVYDMSSPSDQQTDFGKCQSSDLQYDTESYDFTLDGTSPSCAGLDSE
SQSQWTGQYDDYQETNSKSPYQNQNRLPMMYRSQSELPSDDSEEAAPKSWHSRLSIDLSD
KTFSFPKFGSTLQRAKSALEVVWNKSTQSLSGYEDSGSSFMGRFRTLSQSTANESSTTLD
SDVYAEPYYYKADYEEDLIEPPGENETDYVEVMEQVLAKLENRTNSSETSEQVQEYDLGQ
PPCESPYTILPEEQYDGQFDGLVSEEVLEVESDMDAHVDAHVEIREDENQNVQEMLTEAP
KKKRIRPSFKEAALKAYKKQMNDLEDKIHSEDSGSVDEKARIVSGSSLDTSKLYAIQAFS
GSGRGLYGIDSMPDLRRKKSFPIVRDVAMTLAARKSGISMAMLIRTSINNEEMKIHVFKK
TLQALIYPISSTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLL
NADCLQRAAEKSSKHGAEDKTQNIISAMKERMKIREKNRPEVFEVIQEMFDISKEDFVQY
TKAAKQSVLDGTSKWSAKITITVLCAQGLQAKDKTGSSDPYVTVQVGKTKRRTKTIFGNL
NPVWDEKFYFECHNSTDRIKVRVWDEDDDIKSRVKQHFKKESDDFLGQTIIEVRTLSGEM
DVWYNLEKRTDKSAVSGALRLKINVEIEGEEKVAPYHVQYTCLHENLFHYLTEVKSNGVV
KIPEVRGDDAWKVYFDAAAQEIVDEFAMRYGIEYIYQAMTHFSCLSSKYMCPGVPAVMST
LLANINAFYAHTTATTNVSASDRFAATNFGREKFIKLLDQLHNSLRIDLSKYRDNFPASN
SERLQDLKSTVDLLTSITFFRMKVLELQSPPRASTVVKDCVRACLDSTYKYIFDNCYDLY
SQLIDQGKKQEVPKEEQGPTTKNLDFWAQLITLMVTIIDEDKTAYTPVLNQFPQELNMGK
ISAEIMWTLFAQDMKYALEEHENQRLCKSTDYMNLHFKVKWFYNEYVRELHAFKDAVPEY
SLWFEPFVIQWLDENEDVSMEFLHGALERDKKDGFQQTSDHALFSCSVVDVFTQLNQSFE
IIRKLECPNPEALSHLMRRFAKTINKVLLQYAAIISSYFSSYCDKENVPCILMNNIQQLR
VQLEKMFESMGGKELDQEASAVLKELQAKLSNVLDELSVTYATSFQSIIEDCIRQMSSEL
NQMRGNGTAAANKNSAAIDAEIVLRPLMDFLDKTLSLSAKICEKTVLKRVLKELWKIVLN
RIEKQIVLPPLTDQTGPQMIFSAAKDLGQLSKLKDHVIRDDAKSLTLRQCAIMEVALATI
KQYFHAGGSGLKKNFLEKSPDLHSLKYALSLYTQTTDALIKKFIDTQKSQSQTTNNSVGE
ISVQVDLSTHPGTGEHKVTVKVVAINNLNWQTTAMFRPFVEVCVLGPNLSDKKRKHGTKT
KSNTWSPKYNETFQFILSNEDKPGAYELHLSVKDYCFAREDRIIGMTVIQLQKIAEKGSC
ASWYPLLRNIFVDETGLTILRILSQRTNDEVAREFVRLKSETRSAEETA
Download sequence
Identical sequences G1N313
ENSMGAP00000006070 ENSMGAP00000006070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]