SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006192 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006192
Domain Number 1 Region: 102-312
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.79e-54
Family DBL homology domain (DH-domain) 0.0000621
Further Details:      
 
Domain Number 2 Region: 324-449
Classification Level Classification E-value
Superfamily PH domain-like 5.75e-20
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006192   Gene: ENSMGAG00000006179   Transcript: ENSMGAT00000006939
Sequence length 524
Comment pep:known_by_projection chromosome:UMD2:14:8777886:8810422:-1 gene:ENSMGAG00000006179 transcript:ENSMGAT00000006939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAKDYPFYLSVKRANCALDVEAASSPAKETEEPSNKRVKPLSRVTSLANLIPPVRATPL
KRFSQTLQRSISFRSDSRPDLFSPRPWSRNTPAANTKRRDSKLWSETFDVCVNHMLTSKE
IKRQEAIFELSKGEEDLIEDLKLAKKAYHDPMLKLSIMTEQELNQIFGTLDSLIPLHEDL
LRRLQEVRKSDGSTEHVGHILVGWLPCLNSYDSYCSNQVAAKALLDHKKQDHRVQDFLQR
CLESPFSRKLDLWNFLDIPRSRLVKYPLLLREILRHTPNDHPDQQHLEEAINIIQGIVAE
INIKTGESECQYYKERLIYLEEGQRDSLIDNSRVLCCHGELKNNRGVKLHVFLFQEVLVI
TRAITHNEQLCYQLYRQPIPVMDLVLEDLQDGEVRLGGSIRGAFSNNERIKNFFRVSFKN
GSQSQSHSLQANDSFNKQQWLNCIRQAKEKVACAGKAGVLSSEACFILSPNGSRVSQGET
MIEQMDQSDSESDCSMDTSEISIDCERMEQTNPCENEKQIETNV
Download sequence
Identical sequences G1N3B4
ENSMGAP00000006192 ENSMGAP00000006192 XP_010716791.1.16129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]