SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006239 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006239
Domain Number 1 Region: 247-497
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.52e-25
Family Glutaminyl-peptide cyclotransferase-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006239   Gene: ENSMGAG00000006212   Transcript: ENSMGAT00000006986
Sequence length 717
Comment pep:known_by_projection scaffold:UMD2:GL425607.1:22401:33654:1 gene:ENSMGAG00000006212 transcript:ENSMGAT00000006986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRAGSRRGVTAVVGSCWVSLHAWCGPLPALLFAVLVAGSCEGNSVERKIYIPLNKTAPC
VRLLNATHQIGCQSSISGDTGVIHVVEKEEDLNWVLADGPHPPYMILLDGSLFNRKVMQQ
LKGTSRVSGLAVSIAKPNPPQGFSPGLKCPNDGFGVYSKDYGPQYAHCNRTVWNPVGSGL
SYEDFDFPIFLLEDANETQVIKQCYQDHNVPTDGSGPEYPLCAMQLFSHMHAVTSTVTCM
RRNSIQNTFSINPETVCDPLLDYNVWSTLHPINSSEKVDPKKEFIMVATRIDSHSFFWNI
APGAESAVSSFVTHLAAAEALHKASDVHLLQRNIMFTFFQGETFDYIGSSRMVYDMEKDK
FPLRLENIHSFVELNQVALRNDSILWMHTDPVSRLNATVEPQIKNLLDVLSNSSVGANVT
LQEVGFSQSLPPSSFQRFLRARHIPGVVLTDHQASFQNRYYQSMYDTPENIQMQYPEGLS
PEEALEYVTDTAKSLAEVATVVARALYRLAGGANDTSAIQADPKTITQMLYGFLIKMNNS
WFQSIIKPDLKGILGDDVPQHYVAVSSPVNTTYLVQYVLANLTGTVVNLTKEECLNPEKA
PNTEKEMYDYAWVQGSLDPNSTSRVPYCVRSTVRLSKALSPAFELREWGSTEYSTWTESR
WKEIRARIFLVASKELEIITLVVGIAILVFSLVATHFINAKADVLFSIPRDPGAVAY
Download sequence
Identical sequences H9H0Y2
ENSMGAP00000006239 ENSMGAP00000006239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]