SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006318 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006318
Domain Number 1 Region: 20-303
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.99e-64
Family BAR domain 0.00000000238
Further Details:      
 
Domain Number 2 Region: 481-633
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-28
Family Phosphotyrosine-binding domain (PTB) 0.015
Further Details:      
 
Domain Number 3 Region: 279-374
Classification Level Classification E-value
Superfamily PH domain-like 8.73e-23
Family Pleckstrin-homology domain (PH domain) 0.00000286
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000006318
Domain Number - Region: 620-675
Classification Level Classification E-value
Superfamily Gam-like 0.0719
Family Gam-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006318   Gene: ENSMGAG00000006252   Transcript: ENSMGAT00000007066
Sequence length 709
Comment pep:known_by_projection chromosome:UMD2:14:8998818:9018436:1 gene:ENSMGAG00000006252 transcript:ENSMGAT00000007066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HLNTSLLTWHVVLSDSFLQTRSLLGVFEEDAAAISNYVNQLFQAMHRVYDAQNELSAATH
LTSKLLKEYEKQHFPLGGDDEVMNSTLQQFAKVIDELSSCHAVLSTQLADAMMFPITQFK
ERDLKEILTLKEVFQIASNDHDAAIIRYSRLSKRRENEKIKAEVTEDVYTSRKKQHQTMM
HYFCALNTLQYKKKIAVLEPLLGYMQAQISFFKMGSENLTEQLEEFLTNIGTSVQNVRRE
MECEIENMQQTIEDLEVASDPLYLPDPDPAKFPVHRNLTRKAGYLNARNKTGLVSSSWER
QFYFTQGGNLMSQARGDVAGGLVMDIDNCSVMAVDCEDRRYCFQITSFDGKKSSILQAES
KKDYEEWICTINNISKQIYLSENPEEIAARVNQSALEAVTPSPSFQQRHESMRPTVQPRP
PAARTSSTGSLGSESAALSALSLDSLVAPDTPIQFDIISPVSEDLPGQAKSSGQSGRRTN
PFGETGGSKSETEDSILHQLFIVRFLGSMEVKSDESPDVVYETMRQILAARAIHNIFRMT
ESHLLVTCDCLKLIDPQTQVTRLRFPLPNVVLYATHQENKRLFGFVLRTSGGRADSRQTS
ICYIFESNNEGEKICDSVGLAKQIAFHAELDRKASEKQKEMERVKEKQQKELTKQKQIEK
DLEEQSRLIAASNRSNPSSGEGQFVVLSSSQSEDSDLGEDGKKKRESET
Download sequence
Identical sequences G1N3L6
ENSMGAP00000006318 ENSMGAP00000006318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]