SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006356 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006356
Domain Number 1 Region: 17-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.97e-57
Family BAR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 251-444
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.14e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006356   Gene: ENSMGAG00000006311   Transcript: ENSMGAT00000007105
Sequence length 882
Comment pep:known_by_projection chromosome:UMD2:16:6878301:6901230:-1 gene:ENSMGAG00000006311 transcript:ENSMGAT00000007105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKLKSNPLKKLNVLFSLPRAEKTEVLSEDLLQIERRLDTVRSVFHIAQKRLIACSQGQYG
TDPDKRHKKLPLTALAQNMQEGSAQLSDETLLGKMLDTCGDAENKLALELSQHEVQIEKD
ILEPLSTLTEVEIPNIQKQRKQLAKLVLDWDSARGRYNQAHKTSGTNFQMHPSKIDSLKE
EMDEAGNKVEQCKDQLAADMYNFVSKEGEYAKFFVMLLEAQADYHRKALTVIEKVLPEIQ
AHQDKWTEKPAFGTPLEEHLKRSGREIAIPIEACVMMLLETGMKEEGLFRIAAGASKLKK
LKAALDCSTSQLDEFYSDPHAVAGALKSYLRELPEPLMTYSLYEEWTQAANIQDQDKKLQ
ELWKICNKLPKHYHANFRYLIKFLAKLAQNSDVNKMTPSNVAIVLGPNLLWAKTEGSLAE
MAAATSVHVVAIIEPIIQHADWFFPGDQDFNVSGAFVAVPAVNSNHLSHTGNEYDSGTLE
RKRPVSMAVMEGDLLKKESFGVKVMDFQANPRRCGTINRKHTSPAFQPPLPPTEAGMLAH
SGAEQHSQAAVAETSPVGAGFALSAGTAEQLQSQGNEDVSTSKPKDNTSSATPPPVRNGG
HVNNAPNQSASSSNQLSVNQPQNAAGPSPHSVRRAVKKPAPAPPKPANPPPGQPGSQSSA
PAAQPPSISPKPLARSSSPPAQHTNQGAALTSSSQVSAPRRYSSSLSPIQAPSHPPPQPP
TQATPPLQPKANNQASPAALSSEHGPEQPCYTPPQTPTPPDTPPLGKHSTSSPLSQPQSS
TQDTSQSHSPPHSGTLPRPRPVPKPRNRPSVPPPPHPPSQLAGDGIIANPTQTASKIVTD
SNSSIPEPLQNPSAELPTEAVGKELHNHLPLDIDNDTESTAL
Download sequence
Identical sequences G1N3P1
ENSMGAP00000006356 ENSMGAP00000006356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]