SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006471 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006471
Domain Number 1 Region: 781-1079
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.18e-52
Family Pancreatic carboxypeptidases 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006471   Gene: ENSMGAG00000006444   Transcript: ENSMGAT00000007224
Sequence length 1107
Comment pep:known_by_projection chromosome:UMD2:Z:43164779:43196957:-1 gene:ENSMGAG00000006444 transcript:ENSMGAT00000007224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YIETKTASFSLTEKTKKEMTSKGSSAVEVILSTLEVTMLATISCVLQLFQFTVQTLKTIT
VLCTSRYINSMLSSVNKQRSKKQKILTIRMCKVTFVSPSKLDKKIGMKARINGALNITLN
LVKQNLQNHRLILPCLQVLRVYSTNSVNAVSLGKNGVVELMFKIIGPFSKKNTSLMKVAL
DTLAALLKSKTNARRAVDRGYVHMLLTIYFASGWYVMTVLSMHIWSCFWRYIKIGNKTLF
NLSYIFIIVKCNIKCVCPNLLFILINWNKVLILNHCGSPFFYMMRKLEASLIYKMFAWCL
EGITFTLLCLPLVIFVHFQIQENSLVNNEVAVGKLLQNKEVKNDSGCSRLDILLDGLEIC
NQRIGKLVEGVRFSSQPLLRRCSDHSPSVFSLLVSSVVPDANLGGPIVVPTAGEEFLAET
NPSVIGISLKESNPLLTEEYNRRPAFLELPKKDSIKDNSLLRQNIQRNMLPSCQCLSQEI
VKGLDRISLQNTAENDQYYATECVVKKENKTSLTPLACSKTCEHVSPCGSSLFEGSSVHL
GKFCCTGVESEEEDSKSSSSEEQVMLEVSDVSPVHDCDLYIEMVKTTKSIPEYSEVAYPD
YFGHIPPPFKEPILERPYGVQSGEKNKKVNKLNHLCEIYRIYIYLLMKKSCKFSCSFFIL
YHSEFFLSIPLLTEISKIKYNLSIQCSFFLEINFYIKSVIFLFSLLKAIVTDYQFHLGMQ
PLMYSVQEALNSRPSWTRVGADICYYKNHFSRSSIAAGGQKGKSYYTITFTVTFQHKDDV
CYFAYHYPYTYSTLKMKMHLQKLESMHNPQQIYFRQDALCETLAGNTCPVVTITAMPESN
YYEHICQFRNRPYIFLSARVHPGETNSSWVMKGTLEYLMSNNPSAQSLRESYIFKIIPML
NPDGVINGNHRCSLSGEDLNRQWQNPNPDLHPTIYHAKGLLQYLAAIKRLPLVYCDYHGH
SRKKNVFMYGCSIKETMWHTNVNTTSCDLMEDPGYRVLPKILSQTAPAFCMGSCSFVVEK
SKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKGLQIGTRELEEMGAKFCVGLLRLKR
MTSPLEYNLPSGLLDIESELIESSCKV
Download sequence
Identical sequences G1N3Y3
ENSMGAP00000006471 ENSMGAP00000006471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]