SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006666 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006666
Domain Number 1 Region: 319-572
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.06e-108
Family STAT DNA-binding domain 0.000000000674
Further Details:      
 
Domain Number 2 Region: 137-319
Classification Level Classification E-value
Superfamily STAT 1.1e-62
Family STAT 0.000000126
Further Details:      
 
Domain Number 3 Region: 1-120
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 2.22e-44
Family Transcription factor STAT-4 N-domain 0.0000133
Further Details:      
 
Domain Number 4 Region: 573-711
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-43
Family SH2 domain 0.00000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006666   Gene: ENSMGAG00000006382   Transcript: ENSMGAT00000007421
Sequence length 754
Comment pep:known_by_projection chromosome:UMD2:7:7919176:7936524:-1 gene:ENSMGAG00000006382 transcript:ENSMGAT00000007421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQWYQLQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLENQDWEHAANNVSFATVLFHDL
LSQLDDQFSRFLIENNFLLQHNIRKSKRNLQDNFQEDPIHMAMIIHNCLKEERKILNSAQ
LSNQMEVGGVQNTMTGMLDKQKELDAKVKAVKNSVTDVEQDIKTLEDVQDEYDFKHKTFQ
NREYEPNGASQEECKKEQMNLQKMFFLLDIKRKEVVTKIIQLLNTTEHTQSALINEELVE
WKRRQQTACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKLTYDPDPITKNK
QVLQDRTHSLFKQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNL
KVKVLFDKDVNEKNSVKGFRKFNILGTNTKVMNMEESTNGSLAAEFRHLQLKEQKNAGNR
TNEGPLIVTEELHSLSFETQLCQPGLVIELETTSLPIIVISNVSQLPSGWASILWFNMLS
SDPKNLSFFLNPPCAKWSKLSEVLSWQFSSVTKRGLNTDQLNMLGEKLLGPTSGGSHDGL
IPWTRFCKENLNDKSFPFWLWIEGILELIKKHLLCLWNDGCIMGFISKDKERALLKDQRP
GTFLLRFSESSKEGAITFTWVEGSQNEPQFHSVEPYTKKELSAVTFPDIIRNYKVMAAEN
IPENPLRFLYPDIPKDNAFGKYYSRPKEAPEPMDTDTPKGNGYIRTELISVSEVHPSRLQ
SPENLLPMSPEEFDEVSRMVDPAEIDTVMCSAYT
Download sequence
Identical sequences G1N4C3
ENSMGAP00000006666 ENSMGAP00000006666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]