SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006675 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006675
Domain Number 1 Region: 168-367
Classification Level Classification E-value
Superfamily E set domains 3.13e-79
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000765
Further Details:      
 
Domain Number 2 Region: 65-184
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.49e-25
Family Voltage-gated potassium channels 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006675   Gene: ENSMGAG00000006648   Transcript: ENSMGAT00000007430
Sequence length 427
Comment pep:known_by_projection chromosome:UMD2:20:6875667:6882399:-1 gene:ENSMGAG00000006648 transcript:ENSMGAT00000007430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN
VGEKGQRYLADIFTTCVDIRWRWMLVIFCLTFILSWLFFGCVFWLIALLHGDLENQENNK
PCVSQVSSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVM
AKMAKPKKRNETLVFSHNAVVAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG
EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDMDNADFEIVVILEG
MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKNYYKVDYSRFHKTYEVPNTPICSARD
LAEKKYILSNANSFCYENEVALTSKEEDEIDTGVPESTSTDTHPDMDHHNQAGVPLEPRP
LRRESEI
Download sequence
Identical sequences A0A0A0UEH9 A0A226NB26 G1N4D0 O42229
ENSMGAP00000006675 9031.ENSGALP00000006967 ENSGALP00000006967 ENSGALP00000006967 ENSMGAP00000006675 XP_003211597.1.16129 XP_015735577.1.68032 XP_021270167.1.32913 XP_021270168.1.32913 XP_021270169.1.32913 XP_021270170.1.32913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]