SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006679 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006679
Domain Number 1 Region: 145-339
Classification Level Classification E-value
Superfamily E set domains 1.54e-62
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000272
Further Details:      
 
Domain Number 2 Region: 58-160
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000196
Family Voltage-gated potassium channels 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006679   Gene: ENSMGAG00000006653   Transcript: ENSMGAT00000007435
Sequence length 411
Comment pep:known_by_projection chromosome:UMD2:20:6896531:6897867:-1 gene:ENSMGAG00000006653 transcript:ENSMGAT00000007435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEQSGCYRPVNIQGNKISYKGFCKKSPEMGMKRQQKRFLHKDGSCNVYFKHIFGEWESY
VVDIFTTLVDIKWRHMFVIFSLSYVLSWLFFGLVFWLIAMQHGDLLNDEETTPCVANVHS
FTGAFLFSLETQVAVLMVILQSVLSCIIDTFIIGAALAKMATARKRAQTIRFSYYAVVGL
RDDKFCLMWRIGDFRPNHMVEGSVRAQLLRYREDKEGRMTMEYKDLKLLNDQIILVTPVT
VVHEINSESPLYGLDRKALAKDNFEILVTFVYTGDSTGTSHQSRSSYVPREILWGYRFND
VLHVKKKYYKVDCLQFEETTEVYAPHCSAMQLDRKEQEWNRTEKMLEKEAETSVTEIKSL
SENQKSFSAVALITSCEDPEDSVATVSQPSGEASYQKAAVTLSRLSLESQI
Download sequence
Identical sequences G1N4D4
ENSMGAP00000006679 ENSMGAP00000006679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]