SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006748 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006748
Domain Number 1 Region: 189-529
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.87e-88
Family Protein kinases, catalytic subunit 0.00000000000791
Further Details:      
 
Domain Number 2 Region: 37-186
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.12e-40
Family Regulator of G-protein signaling, RGS 0.000000396
Further Details:      
 
Domain Number 3 Region: 556-664
Classification Level Classification E-value
Superfamily PH domain-like 7.95e-25
Family Pleckstrin-homology domain (PH domain) 0.00000488
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006748   Gene: ENSMGAG00000006659   Transcript: ENSMGAT00000007505
Sequence length 690
Comment pep:known_by_projection chromosome:UMD2:17:7257805:7291600:1 gene:ENSMGAG00000006659 transcript:ENSMGAT00000007505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RASLPCCISELACSFSFPDMSSVKPTSCRDQRSFLQIPFSIRSVMQKYLEERGELTFDKI
FHQKIGFLLFKDYCMNEIDEAVPQLKFYEEIKEYEKLDSEEERLSRSRQIYDTYIMKELL
SCSHPFSKQAVDHVQTHLSKKQVPASLFQPYIEEICDSLRGKIFHKFMESDKFTRFCQWK
NVELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALN
ERIMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKEMRFYA
TEIILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMA
PEVLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTVNVELPDSFS
PELKSLLEGLLQRDVSKRLGCQGRSAQEVKEHPFFKGIDWQQVYLQKYPPPLIPPRGEVN
AADAFDIGSFDEEDTKGIKLLDSDQELYKNFPLVISERWQQEVAETVYDAVNADTDKIEA
RKRAKNKQLGHEEDYALGKDCIMHGYMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGESRQ
NLLTMEQIVSVEETQIKDKKCILLRIKGGKQFVLQCESDPEFVQWKKELTEAFTEAQRLL
RRAPKFLNKSRSTVVELSKPPLSHRNSNGL
Download sequence
Identical sequences G1N4H8
ENSMGAP00000006748 ENSMGAP00000006748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]