SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006761 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006761
Domain Number 1 Region: 116-414
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.24e-115
Family Pancreatic carboxypeptidases 0.0000000209
Further Details:      
 
Domain Number 2 Region: 17-107
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 1.23e-25
Family Pancreatic carboxypeptidase, activation domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006761   Gene: ENSMGAG00000006671   Transcript: ENSMGAT00000007518
Sequence length 417
Comment pep:known_by_projection chromosome:UMD2:11:12278298:12294811:1 gene:ENSMGAG00000006671 transcript:ENSMGAT00000007518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWAFLVLVGAAVASAHLQDLTFDGHKVFRVIPQNDEQVEIIHSLASKMQVDFWQPDYVNL
VKPKMQVDFRVEADKALEVEHLLKENKMDYKVLIDNLQTALHAQFDSKVRSTGHSYEKYN
TWDKIAAWTADIAAQNPNLVSRSVIGETYEGRPLYLLKLGKSGTNKKAIFMDCGFHAREW
ISPAFCQWFVKEAVETYGTDSTMTKLLNSLDFYVLPVVNIDGYVYTWTNDRMWRKTRSKN
TGSICIGTDPNRNFNAGWCKLGASNRPCDSTYCGSSPESEKETKALADFIREHLSTIKAY
LTIHSYSQLLLFPYSYTYALPQDYNELNTIASAATEKLTSLYNTKYVYGPGATTIYPAAG
GSDDWAYDQGIKYSFTFELRDTGNYGFLLPESQIKPTCEETLLAVKYIASYVLDHLY
Download sequence
Identical sequences G1N4I9
ENSMGAP00000006761 XP_003209150.1.16129 ENSMGAP00000006761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]