SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006803 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006803
Domain Number 1 Region: 12-311
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.51e-88
Family AstE/AspA-like 0.000000000478
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006803   Gene: ENSMGAG00000006753   Transcript: ENSMGAT00000007560
Sequence length 317
Comment pep:known_by_projection chromosome:UMD2:21:7019247:7024803:-1 gene:ENSMGAG00000006753 transcript:ENSMGAT00000007560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKSMTSCSVVPKPPVRRVAIFGGTHGNELSGIFLVKHWQENGAEIQRAGMEVKPFLTNPR
AVKKCTRYIDCDLNRVFDPDNLGQTVVEDIPYEVRRAQEINHIFGPKGSDDAYDLIFDLH
NTTANMGGTLILENSRDDFTIQMCHYIKNALAPERVPVLLIEHPNLKYATTRSVAKHPVG
VEVGPQPQGVVRADILDKMRKIVKHGLDFVHLFNEGKEFPPCTIEVYKIMEKVDYPRNKN
DEVIAIIHPKLQDQDWQPLNNGDPLFLTLDGEVIAYKGDCTVYPTFINEAAYYEKKQAFV
KTIKMELTAEHIRSSVV
Download sequence
Identical sequences G1N4L9
ENSMGAP00000006803 ENSMGAP00000006803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]