SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006844 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006844
Domain Number 1 Region: 95-210
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-31
Family SH2 domain 0.00023
Further Details:      
 
Domain Number 2 Region: 2-94
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.47e-27
Family STAT DNA-binding domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006844   Gene: ENSMGAG00000006798   Transcript: ENSMGAT00000007605
Sequence length 219
Comment pep:known_by_projection scaffold:UMD2:GL425960.1:253:1246:-1 gene:ENSMGAG00000006798 transcript:ENSMGAT00000007605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QERVPFVVAERVPWEKMCETLNLKFTAEVQTTKGLLKEHYFFLAQKIFNDHSATPEDFQS
RSVSWAQFNKEILPGRGFTFWQWFDGVLDLTKRCLKSYWSDRLIIGFISKQYVCKLLSTE
PDGTFLLRFSDSEIGGVTIAHVIRGKDGSSQVENIQPFSAKDLSIRSGDRIRDLRQLRNL
YPNTPKDQAFGCHYNKEQTGKDGRGYVSTAIKMTVESER
Download sequence
Identical sequences H9H134
ENSMGAP00000006844 ENSMGAP00000006844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]