SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006913 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006913
Domain Number 1 Region: 58-368
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.99e-77
Family Protein kinases, catalytic subunit 0.000000000349
Further Details:      
 
Domain Number 2 Region: 337-357,432-549
Classification Level Classification E-value
Superfamily PH domain-like 2.6e-45
Family Pleckstrin-homology domain (PH domain) 0.000000474
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006913   Gene: ENSMGAG00000006838   Transcript: ENSMGAT00000007676
Sequence length 557
Comment pep:known_by_projection chromosome:UMD2:16:7648533:7658973:1 gene:ENSMGAG00000006838 transcript:ENSMGAT00000007676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFQYDAVPIQSSVVLCSCPSPSMVRNQADSSTPPVISTCGSRQGSNMEGTAAESRSSSNS
LPQHTGQQPPQPRKKRPDDFKFGKILGEGSFSTVVLARELTSSREYAIKILEKRHIIKEN
KVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCT
RFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSADSRQGIIFNS
YLGNKSLRYTETNNLTQKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEY
DFPEKFFPKAKDLVEKLLVLDATKRLGCEEMGGYGPLKAHPFFESIVWENLHLQTPPKLT
AYLPAMSEDDEDCYGNYDNLLSQFGCMQVSGSASSHSLSVPETSTPQTSGGNIEQYIHDL
DNNSFELDLQFSEDEKRLLLAKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLT
EGPHLYYVDPVNKVLKGEIPWSLELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCKKI
QEVWRHRYHQNAELDVQ
Download sequence
Identical sequences G1N4V9
ENSMGAP00000006913 ENSMGAP00000006913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]