SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006916 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006916
Domain Number 1 Region: 467-675
Classification Level Classification E-value
Superfamily RNI-like 2.55e-17
Family 28-residue LRR 0.02
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000006916
Domain Number - Region: 31-74
Classification Level Classification E-value
Superfamily PH domain-like 0.000555
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006916   Gene: ENSMGAG00000006844   Transcript: ENSMGAT00000007679
Sequence length 679
Comment pep:known_by_projection chromosome:UMD2:13:15625782:15681614:1 gene:ENSMGAG00000006844 transcript:ENSMGAT00000007679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFVSLQPTGYMENSISYSAIEDVQLLSWENAPKYCLQLTIPGGTVLLQAANSYLRDQWFH
SLQWKKKIYKYKKVLSNPSRWEVVLKEIRTLVDMALTSPLQDDSIHQAPLEIVSKLLSEN
NNLTTQDHESIIVAIAPLLENNHPPPDLCEFFCKHCRERPRSMVVIEVFTPVVQRILKHN
MDFGKCPRLRLFTQEYILALNELNAGMEVVKKFIHSMHGPTGQCPHPRVLPNLVAVCLAA
IYSCYEEFINSRDNSPSLKEIRNGCQQQCDRKPNLPLRLLHTSPDLVSQEATLTESRLKP
VIVTSNEIHVEVEHNNKANQKMTANVGNDSEPNLIDCLMVSPTCSTMSIELSAQADRILG
CYVEILKMLSDYDDWRPALASLLQPIPFPKEALAHEKFTKELKYVIQRFAEDPRQEVHSC
LLSVRAGKDGWFQLYSPGGVACDDDGELFASMVHILMGSCYKTKKFLLSLAENKLGPCML
LALRGNQTMVEILCLMLEYNIIDNNDTQLQIISTLESTDVGKRMYEQLCDRQRELKELQR
KGGPTRLTLPSKSTDADLARLLSSGSFGNLENLSLAFTNVTSACAEHLIKLPSLKQLNLW
STQFGDAGLRLLSEHLTMLQVLNLCETPVTDAGLLALSSMKSLCSLNMNSTKLSADTYED
LKAKLPNLKEVDVRYTEAW
Download sequence
Identical sequences G1N4W1
ENSMGAP00000006916 ENSMGAP00000006916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]