SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007007 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007007
Domain Number 1 Region: 72-245
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.01e-42
Family Pancreatic carboxypeptidases 0.0002
Further Details:      
 
Domain Number 2 Region: 3-54
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000000236
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007007   Gene: ENSMGAG00000006939   Transcript: ENSMGAT00000007772
Sequence length 254
Comment pep:novel scaffold:UMD2:GL426020.1:344:1397:1 gene:ENSMGAG00000006939 transcript:ENSMGAT00000007772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPPQVFPANKDPETPVLNTLPCPAVARYIRINPQSWFENGTICLRAEVLGCAMPDPNNIY
QWPYEPVPTDKLDFRHHNYKEMRKLMKRVNEECPNITRIYSIGKSYLGLKMYVMEISDNP
GRHEVGEPEFRYVAGMHGNEVLGRELLLNLMEYLCREFRRGNPRVVQLVTGTRIHLLPSM
NPDGYETAYRLGSELSGWAMGRWTYEGIDLNHNFADLNTALWDAEDNDLVPHQFPNHYIP
IPEYYTFANATVRT
Download sequence
Identical sequences H9H141
ENSMGAP00000007007 ENSMGAP00000007007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]