SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007037 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007037
Domain Number 1 Region: 1-264
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.14e-41
Family Protein kinases, catalytic subunit 0.0000000352
Further Details:      
 
Domain Number 2 Region: 364-424,454-522
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.06e-19
Family Ankyrin repeat 0.0018
Further Details:      
 
Domain Number 3 Region: 1184-1293
Classification Level Classification E-value
Superfamily DEATH domain 2.8e-18
Family DEATH domain, DD 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007037   Gene: ENSMGAG00000006958   Transcript: ENSMGAT00000007802
Sequence length 1327
Comment pep:novel chromosome:UMD2:Z:43889057:43930591:1 gene:ENSMGAG00000006958 transcript:ENSMGAT00000007802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQFAVVKKCREKSTGQQFAAKFIKKRRTKSSRRGVGREDIEREVSILKEIRHPNVITLHD
VYENKTDVILILELVVPCAGSCNDFLQGSKCDTHESQIRSILKQIYEQPIYWHSFTSSIK
PNLFLVHLARVSRKVRVNILLTSIRIQREAKNEQFVALIPTVKYAKAPEIVNYEPLGLEA
DMWSIGVITYILLSGASPFLGETKQETLANVSAVNYEFEEEFFSNTSALAKDFIRRLLVK
DPKKRMTIQDSLLHPWIKPKDTQQALSRKASAVNMEKFKKFAARRKWKQSVRLISLCQRL
SRSFLSRSNMNVARSDDTLLLLKEGIKLPCGCGERDVDSFAGAAQRTFIEGAYHLLYPRS
ATVFPLQPILFRGNFSTVAIIMRKRQQYQSKDILGIVYIYWILTYQLSLCLLTLHQRSIP
VLQQKRSFSAHYRRSVQKGSFKDTFCSVGSELSSLEEETPLHCASWHGYYSVAKALCEAG
CDVNIKNREGETPLLTASARGYHDIVECLSEHGADLDATDKVSYGLLVDYFYFFIIIILI
IHYHLMNNIEEDGRNIWFCLPVIPEGQYNLFKNTTAFDPKSCFLSHNVIQKKLYFCYVSS
HEQIVHNMTEAQKSHLEDELDPMASVNNLSDILVSVLHQSQKRLVGEELSQVWRYYPYTV
SKELDMAEYICKDQPKVIQESEKLLSFVSTCLESMLIVSSIQQKTFIKYSHICVTHRKDN
VVSQSIEMNYHNIYGFQHQSIHAFKCSSELKKQVCVIENLIKCYYKSWDAVIFHLGLFSR
LPLERAAILSSLIKYLTIISTARTHYSLKEIKYRFGNDLQISEKLFVLDAGASGSKDMKL
LRNHLQEIRSQIISTCPPMTLLCEKMISVLPSWRKMNGPNQLMSLQQFVYDVQEQLNPLA
NEDDLRHIAQQLHSIGEINIMQSETVQDVVLLDPRWLCSNVLGKILSIENPKALHHYRGR
YTIEDIQRLVTDSDVEELIQILDAMDICARDLSSGAMVDIPALIKTDNLHRSWTEDEDEV
LIYGGVRIVPVEHLTPFPCGIFHKVQVNLCRWIHQQSTEGDADIRLWVNGSKIMNRGAEL
LVLLVNHGQGIEVQVRGLETEKIKCCLLLDSVCSTIDNLIATTLPGLLTVKYYLSPQQLR
EHHEPVMVYQPRDFFRAQSQKETSLTNTMGGYKESFSSILCFGCLDVYSQGSLGMDIHVS
DLNLLTRRKLSRLLDPPDPMGKDWCLLAMNLGLPDLVAKYNTNNGTQNDFLSSPVHALLQ
EWSNAPESTVGILMSKLRELGRRDAADFLLKASSVFKINFDANGQEAYASSCNSGTSYNS
ISSVVSR
Download sequence
Identical sequences G1N549
ENSMGAP00000007037 ENSMGAP00000007037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]