SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007149 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007149
Domain Number 1 Region: 189-354
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.4e-45
Family Ankyrin repeat 0.0000403
Further Details:      
 
Domain Number 2 Region: 1-74
Classification Level Classification E-value
Superfamily E set domains 5.37e-17
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007149   Gene: ENSMGAG00000007029   Transcript: ENSMGAT00000007915
Sequence length 357
Comment pep:novel chromosome:UMD2:8:14333475:14335135:-1 gene:ENSMGAG00000007029 transcript:ENSMGAT00000007915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QYAIVFRTPPYHKPKIDRPVTVFLQLKRKRGGDVSDSKQFTYYPVVEDKEEVERKRKKVL
PQFPQHFGGGSHMGGAGGAGGFGAGGGGNLSFPYSSGLGYNNLYSSSPHPVGGYQGGVQM
KASESGDGGDRQVPTESTYCRELQRHAHLCHLWLLARRNAHALLDYSVTADPRMLLAVQR
HLVASQDENGDTPLHLAIIHEQTAVIKQLIEVVVSIPSQQIINITNNLQQTPLHLAVITK
QPQVVQLLLQAHANPLLDRYGNSLLHLALQAGDEEMLRTLLAHLGSATPYLLCLPNFHGL
LPVHLAVKAKSLACLDLLVRKGADVNGVERQGGRTPLHLAVEMENLNMATHLVKKVG
Download sequence
Identical sequences G1N5C9
ENSMGAP00000007149 ENSMGAP00000007149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]