SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007208 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007208
Domain Number 1 Region: 1162-1357
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.73e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000232
Further Details:      
 
Domain Number 2 Region: 952-1075
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-32
Family Pleckstrin-homology domain (PH domain) 0.00000113
Further Details:      
 
Domain Number 3 Region: 36-160
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-19
Family PDZ domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007208   Gene: ENSMGAG00000007092   Transcript: ENSMGAT00000007976
Sequence length 1989
Comment pep:known_by_projection chromosome:UMD2:6:17069739:17135269:1 gene:ENSMGAG00000007092 transcript:ENSMGAT00000007976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCIVRNGVLKGRKDLDIYIKASKNKDGKEQSEAISPSEEEEAFSWPGPKTVVLRRTSQGF
GFTLRHFIVYPPESAVQFSFKDEENGNRQGKQRNRLEPMDTIFVKQVKEGGPAFEAGLCT
GDRIIKVNGESVIGKTYSQVIALIQNSDSMLELSVMPKDEDILQLLQFTKDVTALAYSQD
AYLKGNEAYSGNAHNIPEPPPICYPRLTPTTSVVAQAGDKLSSSDFSLGKQQVSRPVRAL
TQPERAYRMEIQVPPSPTDIAKSNTAVCVCNETVRTVIVPSEKAVDLPSCRNNHAGPSHR
TEEIRYGLKDQTTLKARTTSPSSSVSTAIVLPQTPLTRPGDPNGTVIKASNYVVCPEGIP
STRPSVQATDSPSISTNHYSSPSSHQHIDWKNYKTYKEYVDNRRMHMYGSRTIQERLDSL
RAASQNTTDYNQVVPNRTASQVRRRSTSHDRVPQSAQIRQRSVSQERLEDPVLMKEWPRS
ASQDTLTSPSLSARNHRARSWDYLSKQGEMLENFHSENLIADTNGDRRKTYKWTGFSEQD
DRRGIYDRPRQHAFHMSLRGQNFPLGPSGYISDGRRVGSRASLPGSHFQKVSPDIRMLQP
SRELQTPGGISKPTAVSQERTSLITARSSKSSSLKNSSYAAKPSFPLNQSLDVVASKDQR
TVNHLHQSGLLNQQSRTRGEAAPDHRTEMGKTMQPSSLSPTSAKLVQQTSESSTTSDNTG
VSIRKRSHDFEKENAHEPEILQTDVQGNDKDAVVMRDKSPSGHQTPQPLRHQSYILAVND
QEAASDTTCWLPNDARREVHIKRIEERKASGSTPPGDSLASIPFIDEPTSPSIDHDIAHI
PASAVISASASQAPAITTVPPSPTSPIPLIRRQLSHDHESIRPSILDSQPATKPERSKSY
DEGLDDYRDEEKSSIKHVSSLKGIKVTDSQKSSEDSGSRKDSSSEVFGDASKEGWLHFRQ
LVTDKGKRVGGSIRPWKQLYVVLRGHSLYLYKDKKEQMTPSEEEQPISINACLIDISYCE
TKRKNVFRLTTSDCEYLFQAEDRDNMLAWIKAIQENSNLNDEDTGVTSRDLISRRIKEYS
TMMSKTEPSPKTPRQSLSIRQTLLGTKADQRTQSPHSPKDESERKLLTKDETSPPKDKGT
WRKGIPSIMRKTFEKKPSAVGTFGVRLDDCPPAHTNKYIPLIVDICCKLVEERGLEYTGI
YRVPGNNAAISSMQEELNKGMTDIDVHDDKWRDLNVISSLLKSFFRKLPEPLFTNDKYAD
FIDANRKEDPVERLKTLKRLIHDLPEHHYETLKFLSAHLKTVAENSEKNKMEPRNLAIVF
GPTLVRTSDDNMTHMVTHMPDQYKIVETLIQKHDWFFTEDDAEEPLTAVQEENTVESQPV
PNIDHLLTNIGRTGVSPGDVSDSATSDSTKSKGSWGSGKDQYSKELLVSSIFAAASRKRK
KTKEKPQPSSSEDELDNVFAKKELAEQSRGDAAKEDTAKGEYEKERDAGRKQRMFVLKEK
DSSSKKDVNVVKDEKKSLRKESLLSEEPSLPYHEKRTKSQSLSCQQTLQKHNPKMPISQS
SSQVEETVSDSGTMLSTSSQASQHRYSCKKITSPEIKHSEFLAADVSSITSDYSTTSSSI
YITGLDASMLSPEVQSVTESKGEDADDERSELISEGRPMETDSESDFPVFATSSAAERLS
KGKVSEVFKSSRRNSEESEVSCTEGSSTPKLESRRLFSSHKLIECDTLSRRKSARHKTDS
EGSGDAKSEKDLPTVTKMFDMMKKGRSTSSLATSARSETDKQEPTWRLKITDRLKLRLKS
SADDMFGVGNQKANSAETVKRKNIRRRHTLGGQRDFDEISVLNVWKVQEPSQSRERESEL
SAVNRLKPKCPAQDLSISDWLARERLRTSTTDLNTGETGKPRLENTSLADASKVDLPLSA
EMQADEGSSSSSLTSISRTPPSGPFQPPDQVNGESYQNMNKNNFSPAVDAHPHKLSGTQV
VRSRFYQYL
Download sequence
Identical sequences G1N5H7
ENSMGAP00000007208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]