SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007211 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMGAP00000007211
Domain Number - Region: 204-291
Classification Level Classification E-value
Superfamily Spectrin repeat 0.024
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007211   Gene: ENSMGAG00000007116   Transcript: ENSMGAT00000007979
Sequence length 298
Comment pep:known_by_projection scaffold:UMD2:GL426135.1:226:4280:-1 gene:ENSMGAG00000007116 transcript:ENSMGAT00000007979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTSLTGSFLTADGGAPEPHPGEKKDPEKPPKPTDLAAVSQENVTPEAAAGKTSRGSPSPV
KSQNISSSQTKRRSWRRSSLKGTKRRKSLPPFHEDVTALSQAISLDLPETDRLSMLLLSS
FQFSAQKLEHILEQTEGFSPEAFKANVSSVSEDLKRYIEKLKLDGTLQSCVEKAEGDSSD
SVSDESVCKAKECIARFSAECQAWDELLQRYQKDAEKTSRQLEECRSRQGREDPPDYLQT
SQAEVLSTKPNYQRILDEQGEVLSCMELVLDELQQAAKLLQAFSEDSRQYLRGLSEQL
Download sequence
Identical sequences H9H156
ENSMGAP00000007211 ENSMGAP00000007211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]