SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007246 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007246
Domain Number 1 Region: 7-155
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.59e-30
Family Pancreatic carboxypeptidases 0.0000516
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000007246
Domain Number - Region: 156-186
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000112
Family Carboxypeptidase regulatory domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007246   Gene: ENSMGAG00000007158   Transcript: ENSMGAT00000008015
Sequence length 186
Comment pep:novel scaffold:UMD2:GL426170.1:4:922:-1 gene:ENSMGAG00000007158 transcript:ENSMGAT00000008015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DAVSLQVAPETRAVIDWMQRYPFVLSANLHGGELVVTYPFDMTRTYWKAQELTPTADDGV
FRWLATVYATSNLAMASEERRLCHYDDFMRTGNIINGANWHTVPGSMNDFSYLHTNCFEI
TVELSCDKFPHVSELPTEWENNRESLLLYMEQVHRGIKGVVRDEETGEGIANAIISVDGI
NHDVRT
Download sequence
Identical sequences H9H161
ENSMGAP00000007246 ENSMGAP00000007246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]