SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007294 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007294
Domain Number 1 Region: 1164-1504
Classification Level Classification E-value
Superfamily NHL repeat 9.68e-24
Family NHL repeat 0.0018
Further Details:      
 
Domain Number 2 Region: 1347-1438,1477-1712
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.0000000177
Family DPP6 N-terminal domain-like 0.028
Further Details:      
 
Domain Number 3 Region: 862-943
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000255
Family Carboxypeptidase regulatory domain 0.066
Further Details:      
 
Domain Number 4 Region: 612-639
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000542
Family Integrin beta EGF-like domains 0.076
Further Details:      
 
Domain Number 5 Region: 680-704
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000986
Family Integrin beta EGF-like domains 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007294   Gene: ENSMGAG00000007089   Transcript: ENSMGAT00000008065
Sequence length 2704
Comment pep:known_by_projection chromosome:UMD2:9:15192830:15424093:1 gene:ENSMGAG00000007089 transcript:ENSMGAT00000008065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQMDCKPYQPLSKVKHEVDLTYTSSSDESEDGRKQRQSYDSRETLNEYSQELRLNYNSQ
SKKRKNIDQPTQDMEFCETPHILCSGYQTDLHGVSEHSYPLEVGSDVDTETEGGASPDHA
LRMWMRGMKSEHSSCLSSRANSALSLTDTDHERKSDGENDMPGSPHNQFTFRPLPPPPPP
PHACTCTRKPPPAADSLQRRSMTTRSQPSPAAPTPPTSTQDSVHLHNSWVLNSNIPLETR
HFLFKHGSGSSAIFSAASQNYPLTSNTVYSPPPRPLPRNTFSRPAFTFSKPYRCCNWKCT
ALSATAITVTLALLLAYVIAVHLFGLTWQLQPVEGQLYENGVSKGNKGAESTDTTYSPIG
GKVSDKTEKKVFQKGRAIDTGEVEIGAQVMQTIPPGLFWRFQITIHHPVYLKFNISLAKD
SLLGIYGRRNIPPTHTQFDFVKLMDGKQLIKQEPKNSEEPQQAPRNLILTSLKETGFIEY
MDQGAWHMAFYNDGKKVEQVFVLTTAIEVLDDCSTNCNGNGECISGHCHCFPGFLGPDCA
KDSCPVLCSGNGEYEKGHCVCRNGWKGPECDVPEEQCIDPTCFGHGTCIMGVCICIPGYK
GEICEEEDCLDPMCSGHGVCVQGECHCSAGWGGVNCETSLPICQEQCSGHGTFLLDVGLC
SCEPQWTGSDCSTELCTLDCGSHGVCSRGICQCEEGWVGPTCEERTCHSHCAEHGQCKDG
KCECSPGWEGDHCTIDGCPGLCYGNGRCTLDQNGWHCVCQVGWSGSGCNVVMEMVCGDNL
DNDGDGLTDCVDPDCCQQNNCYVSPLCQGSPDPLDLIQHSQPPFSQHPPRLFYDRIRFLI
GKESTHVIPGDISFESRRACVIRGQVVAIDGTPLVGVNVSFLHHNEYGYTISRQDGSFDL
VAVGGISVTLVFDRSPFISEKRTLWLPWNRFVIVDKVVMQRAESDIPSCDISSFISPNPI
VLPSPLTAFGGSCPERGTVIPELQVVQEEIPIPSSFVKLSYLSSRTPGYKTLLRVILTHT
AIPSGMTKVHLIIAVEGRLLQKWFPAAANLVYTFAWNKTDIYGQKVSGLAEAMVSVGYEY
ETCPDFILWEKRTVILQGFEVDASNLGGWSINKHHVLNPQSGIVHKGNGENMFISQQPPV
ISTVMGNGHQRSVSCSNCNGLALNSKLFAPVALTSGPDGSVYIGDFNFVRRIFPSGNSIG
ILELRNRDTRHSTSPAHKYYLAVDPVSESLYLSDTNTRRVYKAKSLTETKDLAKNVDVVA
GTGDQCLPFDQSHCGDGGKASEASLNSPRGITIDKHGFIYFVDGTMIRKIDENGVITTII
GSNGLTSTQPLSCDSGMDITQVRLEWPTDLTVNPLDNSLYVLDNNIVLQISESRRVRIIA
GRPIHCQVPGIDHFIVSKVAIHSTLESARAIAVSHSGILYIAETDERKINRIQQVTTNGE
ISVIAGAPSDCDCKIDPNCDCFSGDGGYAKDAKLKAPSSLAVSPDDTLYVADLGNVRIRA
ISRNKAHLSDTNMYEIASPADQELYQFTINGTHLHTLNLITRDYIYNFTYSGEGDVVTIT
SSNGNSVHIRRDTSGLPLWVVVPGGQVYWLTISSNGVLKRVYAQGYNLALMTYPGNTGLL
ATKSDENGWTTVYEYDSDGHLTNATFPTGEVSSFHSDVEKLTRVELDTSNRENVVTATNF
SATSTIYTLKQDNTQNIYRVSPDGSLRVTFASGMEITLNTEPHILAGVVSPTLGKCNISL
PGEHNSNLIEWRQRREQTKGNISTFERRLRAHNRNLLSIDFDHVTRTGKIYDDHRKFTLR
IMYDQTGRPVLWSPISKYNEVNITYSHSGLVTYIQRGTWTEKMEYDPSGNIISRTWADGK
IWSYTYLEKSVMLLLHSQRRYIFEYDQSDYLLSVTMPSMVRHALQTMLSVGYYRNIYTPP
DSGAAFIQDVTRDGRLLQTLYPGTGRRVLYKYSKQSRLSEILYDTTQVTFTYEESSGVIK
TIHLMHDGFICTIRYRQTGPLIGRQIFRFSEEGLVNARFDYSYNNFRVTSMQAMINETPL
PIDLYRYVDVSGRTEQFGKFSVINYDLNQVITTTVMKHTKIFSANGQVIEVQYEILKSIA
YWMTIQYDNMGRMVICDIRVGVDANITRYFYEYDADGQLQTVSVNDKPWRYSYDLNGNIN
LLSHGNSARLTPLRYDLRDRITRLGEIQYKMDEDGFLRQRGNEIFEYNSNGLLNKAYNKV
SGWTVQYCYDGLGRRVASKSSLGQHLQFFYADLSNPIRVTHLYNHSSSEITSLYYDLQGH
LIAMELSSGEEYYVACDNTGTPLAVFSSRGQVIKEILYTPYGEIYQDTNPDFQVVIGFHG
GLYDSLTKLVHLGQRDYDVIAGRWTTPNHHIWKHLNAVPQPFNLYSFENNYPVGRIQDVA
KYTTDIGSWLELFGFQLHNVLPGFPKPEIEALETTYELLQLQTKTQEWDPGKTILGIQCE
LQKQLRNFISLDQLPMTPRYSDGKCYEGVKQPRFAAIPSVFGKGIKFAIKDGIVTADIIG
VANEDSRRIAAILNNAHYLENLHFTIEGRDTHYFIKLGSLEEDLALIGNTGGRRILENGV
NVTVSQMTSVINGRTRRFADIQLQHGALCFNVRYGTTVEEEKNHVLEVARQRAVAQAWTK
EQRRLQEGEEGIRAWTDGEKQQLLNTGRVQGYDGYFVLSVEQYLELSDSANNIHFMRQSE
IGRR
Download sequence
Identical sequences G1N5P2
ENSMGAP00000007294 ENSMGAP00000007294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]