SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007387 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007387
Domain Number 1 Region: 695-750
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000264
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 2 Region: 2-43
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000248
Family Somatomedin B domain 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000007387
Domain Number - Region: 38-109
Classification Level Classification E-value
Superfamily E set domains 0.00364
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007387   Gene: ENSMGAG00000007268   Transcript: ENSMGAT00000008159
Sequence length 750
Comment pep:known_by_projection chromosome:UMD2:17:8148996:8161145:-1 gene:ENSMGAG00000007268 transcript:ENSMGAT00000008159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQDSCSSQCGKLLGTCSCQEICQSLGTCCPDYNEFCLQISPYSGSLMGGKDFLIENTAFN
TSVLMCRFKQQVITSGYVDKDGKAHCLSPLLFETGFIPFEVSTDGGLTFPYSGTWLSVHH
SKVSTGEECTLVNETKWQYYGTPGTDGNLTLTWIHQALAAPHINIEVWGYQETGDSYSEN
WLAEWKYLYTLAREAPNTGTFSFIPVPAEANYNTWDFGILRITPSTYSDGQSNIPSIWSP
AHALAWHLGEDFRNEPAAWATAKCIEWDRKEEKLPNFMEEIIDCPCTLAQARADTGRFHT
DYGCDIEKGSVCTYHPGAVHCVRAVQASPQYGAGQQCCYDSTGTQILTQDSTGGSTPDRG
HDWGAPPFLKPPRIPAFSHWLYDVISFYYCCLWSDNCHFYMKNRPSSDCRTYRPPRAEKA
SAFGDPHFLTFDGLNFTFKGQGEYTLVESDLTSLRVQGRTQQARFPNGTQAQVTGLSAVA
MQENNSDVIEVRYSADLNLEVLLNQKVVNFSEQSWLDLEGLFLHSTADQKITVMFSSGSG
VEIRGSGGFLTLTVLLPEKFINHTQGLFGVMNGNTEDEFTFKNKTIMSVHASPQQLFEFG
ANWAVENGTSLFTYDTEILLNDYFYGEKHNASFLPVFYPYEDPADPLVEEMVSLCDSDPF
CRFDVLTTRSLQVGNFTRLSHQNHKQLVESLEPVISCGWLDPPTNGRKDGTNYLLGSAIH
FTCNQGYELTGSKERICQSTGAWSGDSPDC
Download sequence
Identical sequences G1N5W6
ENSMGAP00000007387 ENSMGAP00000007387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]