SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007465 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007465
Domain Number 1 Region: 174-439
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.52e-72
Family Protein kinases, catalytic subunit 0.00000000084
Further Details:      
 
Domain Number 2 Region: 64-206
Classification Level Classification E-value
Superfamily SH2 domain 1.22e-39
Family SH2 domain 0.00000558
Further Details:      
 
Domain Number 3 Region: 7-89
Classification Level Classification E-value
Superfamily SH3-domain 2.27e-21
Family SH3-domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007465   Gene: ENSMGAG00000007338   Transcript: ENSMGAT00000008239
Sequence length 450
Comment pep:known_by_projection chromosome:UMD2:22:10983738:10989106:1 gene:ENSMGAG00000007338 transcript:ENSMGAT00000008239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGSGDNVVLALYDYEAMHSGDLSFQKGEQLQVLEQLGEWWQARSLVTGRKGFIPSNFVAR
ANSLEAEEWFFKGISRKDAERQLLSPGNTLGSFMIRDSETTKGCYSLSVRDGDGLHGGSI
KHYRIRTLDSGGFYISSRSSFDTLQELVEHYKGQSDGLCQRLTYPCSVPKPQKPWEKDAW
EIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVSAFLEEANLMKSLQHD
KLVRLHAVVTREDQAERHAMPSGSLLDFLKSEEGNKQPLPKLIDFSAQIAEGMAFIEKRN
YIHRDLRAANILVSAMLVCKIADFGLARIIEDNEYVAREGAKFPIKWTAPEAINYGSFTI
KSDVWSFGILLTEIVTYGRIPYPGMSSAEVIRALEHGYRMPRTESCPEELYDVMMRCWKT
KPEDRPTFEYMQSILEDFFTATEGQYQQQA
Download sequence
Identical sequences G1N615
ENSMGAP00000007465 ENSMGAP00000007465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]