SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007644 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007644
Domain Number 1 Region: 40-507
Classification Level Classification E-value
Superfamily Sema domain 6.41e-130
Family Sema domain 0.0000293
Further Details:      
 
Domain Number 2 Region: 1343-1469,1666-1855
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.92e-52
Family p120GAP domain-like 0.032
Further Details:      
 
Domain Number 3 Region: 849-948
Classification Level Classification E-value
Superfamily E set domains 6.82e-16
Family Other IPT/TIG domains 0.0097
Further Details:      
 
Domain Number 4 Region: 1032-1136
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000041
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.053
Further Details:      
 
Domain Number 5 Region: 946-1032
Classification Level Classification E-value
Superfamily E set domains 0.000000000000153
Family Other IPT/TIG domains 0.032
Further Details:      
 
Domain Number 6 Region: 510-562
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000327
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 7 Region: 1133-1223
Classification Level Classification E-value
Superfamily E set domains 0.000000252
Family E-set domains of sugar-utilizing enzymes 0.048
Further Details:      
 
Domain Number 8 Region: 803-835
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000445
Family Plexin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007644   Gene: ENSMGAG00000007508   Transcript: ENSMGAT00000008424
Sequence length 1885
Comment pep:known_by_projection chromosome:UMD2:14:10410257:10494324:1 gene:ENSMGAG00000007508 transcript:ENSMGAT00000008424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAMRLLWLKHHLSVNIWTLLLLGSTWLPLAEGSPKSPFRTFSVTDWSLTHLVVHNKTGEV
YVGAVNRIYKLSNNLTLLRTHVTGPVEDNEKCYPPPSVQSCPHGLVTTNNVNKLLLVDYS
GNRLIACGSASQGICQFLRLDDLFKLGEPHHRKEHYLSSVNESGTMSGVIIEVLNGQNKL
FIGTPIDGKSEYFPTLSSRKLMANEENAEMFGFVYQDEFVSSQLKIPSDTLSKFPTFDIY
YIYSFSSEQFVYYLTLQLDTQLTSPDSTGEQFFTSKIVRLCVDDPKFYSYVEFPIGCVQD
GIEYRLIQDAYLTKPGKALAKYLGISEREDILFTIFSQGQKNRVKPPKESVLCLFTLKKI
KDKIKERIQSCYRGEGKLSLPWLLNKELGCINSPLQIDDNFCGQDFNQPLGGTVTIEGTP
LFVDKEDGMTSVAAYDYRGQTVVFAGTRSGKIKKILVDLPADRKHQALQYENVVAHEGSS
ILRDLVLSPDRQHLYAMTEKQVTRVPVESCEQYESCELCLGSRDPHCGWCVLHNVCSRKD
RCERADEPQRFASELRQCVQLTVQPRNISVTMSEVPKVLLQGLECSFGFSSVIQTLGLVS
AERIYCSSPSARDVIPITRGRGDKRVVKLYLKSKETGKKFASVDFVFYNCSVHQSCLSCV
NGSFPCHWCKYRHICTHNAADCSFLEGRVKLSEDCPQILPSTQIYIPVGVVKPITLTAKN
LPQPQSGQRNYECIFHIPGSTTRVTALRFNSTSIQCQNTSYFYEGNDISDLPVNLSVVWN
GNFVIDNPQNIQAHLYKCSALRESCGLCLKADPRFECGWCVSEKRCTLRQHCLAYESSWM
HASSGNSRCTDPKITKLSPETGPRQGGTRLTITGENLGLKFEDVRWGVRVGKVMCIPIES
EYISAEQIVCEIGDASPSKVHDARVEVCIRDCSPNYRATSPKSFTFVTPTFSRVTPARGP
LSGGTWIAIEGSHLNAGSNVTVTIGGRPCAFSGRSAREIRCRTPPGHAVGPPILININRA
ELSNPEVKYNYTEDPTIQKIDPEWSINSGGTLLTVTGTNLATIKEPKIRAKYCSSERENN
CTVYNDTTMVCYAPSIDNPERSPPEVGDRPDEIGFIMDNVQALLIINTTNFVYYPDPVFE
PLSPTGMLELKPSSPLILKGRNLLPPAAGNSRLNYTVLIGDTPCTLTVSETQLLCESPNL
TGQHKVTIKAGGFEFSPGTLQIYSDSLLTLPAIIGIGGGGGLLLLIIIIVLIAYKRKSRD
ADRTLKRLQLQMDNLESRVALECKEAFAELQTDINELTNDLDGAGIPFLDYRTYAMRVLF
PGIEDHPVLKEMEVQANVEKSLTLFGQLLNKKHFLLTFIRTLEAQRSFSMRDRGNVASLI
MTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFL
KECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKMLTLNCVNPENE
NAPEIPVKVLNCDTITQVKEKLLDAVYKGVPYSQRPKAGDMDLGTEWRQGRMARIILQDE
DVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQNSAYNISNSSTFTKSLSRYESMLRTAS
SPDSLRSRTPMITPDLESGTKLWHLVKNHDHMDQREGDRGSKMVSEIYLTRLLATKGTLQ
KFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQINDYDVRHTWKSNCLPLRFWV
NVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKLGKDSPSNKLLYAKDIPNYKS
WVERYYADIAKMPAISDQDMSAYLAEQSRLHLSQFNSMSALHEIYSYITKYKDEILAALE
KDEQARRQRLRSKLEQAIDTMALSS
Download sequence
Identical sequences G1N6E3
ENSMGAP00000007644 ENSMGAP00000007644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]