SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007732 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007732
Domain Number 1 Region: 652-858
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.53e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.000065
Further Details:      
 
Domain Number 2 Region: 163-430
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.85e-42
Family FCH domain 0.011
Further Details:      
 
Domain Number 3 Region: 578-631
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000434
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007732   Gene: ENSMGAG00000007556   Transcript: ENSMGAT00000008513
Sequence length 1234
Comment pep:known_by_projection chromosome:UMD2:10:14229763:14276798:1 gene:ENSMGAG00000007556 transcript:ENSMGAT00000008513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLVNDVRKFADVLLYLKEAICSEENQDGLRQVVHERLGELLRVLKAVINKHQTLNSVDI
LSAAGTVIAKVKAVNFKEVNEENKRELFSEVFSSIETLAFTFGNVISDFLMGDVDNGSSL
GLPVSRRSRSFENLSVESGGSLHERDDIQAEEVDSMLLRNDSGIESALSYAKAWSKYTKD
VVAWVEKKLSLEVECAKNLAKMAETAKAVVGPQDYMPFQSIFLNAFQNDIENNQLRQQTA
AALQSNKFVQPLLGRKNELDRQRKEIKELWQREQKKMQELEASLRKAKLLYTQRQDEYEK
AKSCTARAEEEHVSSSGSFAKDVSKQLEKKRRLEEEALQKAEEANEYYKASMAEVEEKRS
DLESFKSDVLTQLRELIYQCDLTLKAVTVNLFQLQHAQVVSLPVNCQSLCESAKLYDPGQ
QYSEFVKKTQSSQIDGQSANSIHISHGNLSQCSGDFPTQMLDDVGSPVYHRSQRIGEKRS
SSSTDIQVMRGPPPFRSWSVGNQSGGMCSDSESAGGSSESRSMDSPSASPGDFKRRLPRT
PSTGTMSSADDLDEREPPSPSDCGNNTLGPFRNTSMSKAAQTHKLRKLRAPSKCRECDSL
VVFHGAECEECSLACHKKCLETLAIQCGHKKLHGRLHLFGVEFAQAAKSVPDGIPFIIKK
CTSEIESRALNVKGIYRVNGAKSRVEKLCQAFENGKDLVELSDLYAHDISNVLKLYLRQL
PEPLILFRLYNEFIGLAKESQSVSEELDAKQASPKSKKRQSMCIELNRIIIKIKDLLKQL
PVPNYNTLQYLIGHLHRVTEQSDENKMSASNLGIIFGPTLIRPRQTDATVSLSSLVDYPY
QARVVELLITYYEKIFDVSLQPFLSTSQTEENAITVRVALSAEEREPQQQRKSFVAVKEG
VLIAPGENRASETTALLLESNNSKNAKEQVDTSVTGNAVNPASEKDSHSFVSAGEESYKV
NLFPAKPNRQITKVPLRVPRTKPVIRPVSLPVDRILPPCVLNERNSQNAGAESPEKLGRS
PTIEEVSEVKALPAVSTFCRLSCCDTQMLQKTWDKQYKQYDITARTAMIVTNVPQENRAL
ESGTAGALSSSCSNNSANAILPSKPYSLSVRSGRTATDANSSDAHPLAAFRAPRTLQPPP
GTFYKPPSNKSKQSEKSSAEQAKVCASTSASSVLQQDTVKLARSSALSSGNPGQSTNEQK
TGSEDTHSADLKPAYQRLRPKRIQELEHREAHFV
Download sequence
Identical sequences G1N6K9
ENSMGAP00000007732 ENSMGAP00000007732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]