SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007782 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007782
Domain Number 1 Region: 274-348
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000000235
Family Rhamnogalacturonase B, RhgB, middle domain 0.027
Further Details:      
 
Domain Number 2 Region: 907-993
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000298
Family Carboxypeptidase regulatory domain 0.032
Further Details:      
 
Domain Number 3 Region: 72-146
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000432
Family Rhamnogalacturonase B, RhgB, middle domain 0.027
Further Details:      
 
Domain Number 4 Region: 825-897
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000294
Family Rhamnogalacturonase B, RhgB, middle domain 0.042
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000007782
Domain Number - Region: 160-182,210-242
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00412
Family Rhamnogalacturonase B, RhgB, middle domain 0.024
Further Details:      
 
Domain Number - Region: 754-812
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00589
Family Cna protein B-type domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007782   Gene: ENSMGAG00000007582   Transcript: ENSMGAT00000008564
Sequence length 1165
Comment pep:novel chromosome:UMD2:16:8018239:8040821:1 gene:ENSMGAG00000007582 transcript:ENSMGAT00000008564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKLYTKHGTLKYQTDCAPNNGYFMIPLYDKGDFILKIEPPLGWSFEPTGVDIHVDGINDI
CTKGGDINFVFTGFSVNGKVLSKGQSLGPAGVQVVLRNAGSDVNLQATITQPGGKFAFFK
VLPGEYEIFASHPTWMLKESNTVVRVTSSNAYAASPLIVAGYNVSGSVRSDGEPMKGVMF
LLFSSSVTKEDVVGCNISPVDGFQSRDESLSYLCNVVSKEDGSFSFLSLPSGKYTVIPFY
RGERITFDVAPSRLDFFVEHDSLQIEPVFHVMGFSVTGRVLNGPEGEGVADATVTLNNQI
KVKTKADGSFRLENITTGTYTIHARKEHLFFDTITVKIAPNTPQLADIIATGFSVCGQIS
VTRLPDAVKQISKYKVTMVPQDKDKASMVTTETDPHGGFCFKAKSGAYSVKVIIPEAETR
AGLALKPKVFPVTVTDRPVMDVTFSQFLASVSGKISCLDACGDLVVMLQSVSRQGEKRNL
QLSGRTDSVAFAFENVLPGKYKVSIIHEDWCWKNKSLEVEIMEDDVSGVEFRQTGYMLRC
SLSHAITLEFYQDGNGPENVGVYNLSKGVNRFCLSKPGVYEVTPRSCHQFEHEYYTYDTS
SPSILTLTAVRHHVLGTIVTDKLMDVTITIKSSIDSEPALVLGPLKSVQELRREQQLAEI
ETRRQEREKKGQEEEGTKPPVQEMVEELQGPFLYEFSYWARSGEKITVTPSSKELLFYPP
YVETVVSGESCPGKLIEIHGKAGLFMEGRIHPELEGVEIVIGEKGAPSPLITVFTDDKGA
YSVGPLHSDLEYTVTAQKEGFVLTAVEGTVGDFKAFALAGVTFEIKSEDDQALAGVLLSL
SGGVFRSNLLTQDDGMLTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLKIRITGY
RTAYSCYGTVSSLNGEPEQGVSVEAVGQEGCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQ
LKAEGNDHIERALPQHRAIEVGNSDIDDVNIIAFRQINQFDLSGNVITSSEYLSTLCVKL
YKSENLDNPIHTVNLGQSLFFHFPPLLRDGENYVVLLDSTLSKSQYDYILPQVSFTSIGY
HKHITLVFSPTRKLPEQDIAQGSYIALPLTLLLLLAGYNHDKLIPLLLQLTTRLQGVRAL
GQAGSDTGGPEDAKRQTKKQKTRRT
Download sequence
Identical sequences G1N6P7
ENSMGAP00000007782 ENSMGAP00000007782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]